Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rad21l ORF Vector (Mouse) (pORF)
38413014 1.0 µg DNA

Rad21l ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Human MIA Protein
NBP2-61365-5ug 5 µg

Recombinant Human MIA Protein

Sign In for Pricing
View Details
NEDD9 (Neural Precursor Cell Expressed Developmentally Down-regulated protein 9, Enhancer of Filamentation 1, hEF1, CRK-associated Substrate-related Protein, CAS-L, CasL, Cas Scaffolding Protein Family Member 2, NEDD-9, Renal Carcinoma Antigen NY-REN-12, p105, CASL, CASS2) (FITC)
130261-FITC 100 µL

NEDD9 (Neural Precursor Cell Expressed Developmentally Down-regulated protein 9, Enhancer of Filamentation 1, hEF1, CRK-associated Substrate-related Protein, CAS-L, CasL, Cas Scaffolding Protein Family Member 2, NEDD-9, Renal Carcinoma Antigen NY-REN-12, p105, CASL, CASS2) (FITC)

Sign In for Pricing
View Details
Slc35f1 3'UTR Luciferase Stable Cell Line
TU119101 1.0 mL

Slc35f1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Pitpnm2 shRNA (UAS) - Lentiviral mouse Pitpnm2 shRNA (UAS, iRFP) plasmid
GTR15270196 1 Vial

Lentiviral mouse Pitpnm2 shRNA (UAS) - Lentiviral mouse Pitpnm2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
HERV-FRD (ERVFRD-1) Human qPCR Primer Pair (NM_207582)
HP219802 200 Reactions

HERV-FRD (ERVFRD-1) Human qPCR Primer Pair (NM_207582)

Sign In for Pricing
View Details