Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFR-2/TEAD-4, Mouse

ETFR-2/TEAD-4 protein is a key transcription factor that tightly regulates the Hippo signaling pathway and is an integral component of organ size control and tumor suppression. In this pathway, it mediates a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1, leading to the inactivation of YAP1 and WWTR1/TAZ. ETFR-2/TEAD-4 Protein, Mouse is the recombinant mouse-derived ETFR-2/TEAD-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

ETFR-2/TEAD-4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/etfr-2-tead-4-protein-mouse.html

Purity

97.00

Smiles

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

21679 (Gene_ID) Q62296-1 (R210-E427) (Accession)

Molecular Weight

Approximately 25.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Neuronal Cell Culture Medium w/o Glycine, Serine, Aspartic Acid, Cystine, Glutamine, Glutamic Acid (Powder)
N1020-01-01 10 L

Neuronal Cell Culture Medium w/o Glycine, Serine, Aspartic Acid, Cystine, Glutamine, Glutamic Acid (Powder)

Ask
View Details
Neuronal Cell Culture Medium w/o Glycine, Serine, Aspartic Acid, Cystine, Glutamine, Glutamic Acid (Powder)
N1020-01-02 25 L

Neuronal Cell Culture Medium w/o Glycine, Serine, Aspartic Acid, Cystine, Glutamine, Glutamic Acid (Powder)

Ask
View Details
Neuronal Cell Culture Medium w/o Glycine, Serine, Aspartic Acid, Cystine, Glutamine, Glutamic Acid (Powder)
N1020-01-03 50 L

Neuronal Cell Culture Medium w/o Glycine, Serine, Aspartic Acid, Cystine, Glutamine, Glutamic Acid (Powder)

Ask
View Details
Neuronal Cell Culture Medium w/o Glycine, Serine, Aspartic Acid, Cystine, Glutamine, Glutamic Acid (Powder)
N1020-01-04 100 L

Neuronal Cell Culture Medium w/o Glycine, Serine, Aspartic Acid, Cystine, Glutamine, Glutamic Acid (Powder)

Ask
View Details
Dicyclopentyl Carbonate
TRC-D439665-500MG 500 mg

Dicyclopentyl Carbonate

Ask
View Details
Lentiviral mouse Kdm2b shRNA (UAS) - Lentiviral mouse Kdm2b shRNA (UAS, GFP) plasmid
GTR15131158 1 Vial

Lentiviral mouse Kdm2b shRNA (UAS) - Lentiviral mouse Kdm2b shRNA (UAS, GFP) plasmid

Ask
View Details