Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pyridine nucleotide-disulfide oxidoReductase domain-containing protein 1 (PYROXD1) Mouse ELISA Kit

Product Specifications

No additional specifications available.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MMP12 Pre-designed siRNA Set B
SI009663B 1 Each

Human MMP12 Pre-designed siRNA Set B

Sign In for Pricing
View Details
RPL8P2 CRISPR Knock Out 293T Cell Line (Human)
41926141 1x 10^6 Cells / 1.0 mL

RPL8P2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
KK LC 1 (CT83) (NM_001017978) Human Tagged Lenti ORF Clone
RC209391L1 10 µg

KK LC 1 (CT83) (NM_001017978) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-02 10 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
Prokaryotic Dog Alpha-Fetoprotein
RPU61611-01 50 µg

Prokaryotic Dog Alpha-Fetoprotein

Sign In for Pricing
View Details