B7-2/CD86, Human (HEK293, Fc)
B7-2/CD86 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-termimal human IgG1 Fc fragment produced in HEK293 cells. B7-2 (CD86) is a costimulatory molecule expressed by antigen-presenting cells (APCs), which interacts with CD28 for T-cell activation and survival and with CTLA4 for immune regulation.
Product Specifications
Product Name Alternative
B7-2/CD86 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-2-cd86-protein-human-hek293-fc.html
Purity
97.00
Smiles
LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Molecular Formula
942 (Gene_ID) P42081-1 (L20-P247) (Accession)
Molecular Weight
65-80 kDa
References & Citations
[1]Han L, et al. A monoclonal antibody against CD86 and its protection in a murine lupus nephritis model of chronic graft-versus-host disease. Immunopharmacol Immunotoxicol. 2017 Oct;39 (5) :285-291.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR210138L4V 200 µL
Sorcs1 (BC007486) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
EK11F773-01 48 Test
Bovine Methionine Aminopeptidase 2 (METAP2) ELISA Kit-Sandwich
Sign In for Pricing
View Details EK11F773-02 96 Tests
Bovine Methionine Aminopeptidase 2 (METAP2) ELISA Kit-Sandwich
Sign In for Pricing
View Details AMM10649VCF 100 µg
GALE Mouse Monoclonal Antibody [Clone ID: LBI1C4]
Sign In for Pricing
View Details