B7-2/CD86, Human (HEK293, Fc)
B7-2/CD86 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-termimal human IgG1 Fc fragment produced in HEK293 cells. B7-2 (CD86) is a costimulatory molecule expressed by antigen-presenting cells (APCs), which interacts with CD28 for T-cell activation and survival and with CTLA4 for immune regulation.
Product Specifications
Product Name Alternative
B7-2/CD86 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-2-cd86-protein-human-hek293-fc.html
Purity
97.00
Smiles
LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Molecular Formula
942 (Gene_ID) P42081-1 (L20-P247) (Accession)
Molecular Weight
65-80 kDa
References & Citations
[1]Han L, et al. A monoclonal antibody against CD86 and its protection in a murine lupus nephritis model of chronic graft-versus-host disease. Immunopharmacol Immunotoxicol. 2017 Oct;39 (5) :285-291.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15355597 1 Vial
Lentiviral human SLC35B3 sgRNA gene knockout kit - Lentiviral human SLC35B3 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 
MBS7056204 Inquire
Recombinant Neotoma floridana NADH-ubiquinone oxidoreductase chain 3 (MT-ND3), partial
Sign In for Pricing
View Details TL500293V 500 µL Each
Cbx3 Mouse shRNA Lentiviral Particle (Locus ID 12417)
Sign In for Pricing
View Details