Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-2/CD86, Human (HEK293, Fc)

B7-2/CD86 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-termimal human IgG1 Fc fragment produced in HEK293 cells. B7-2 (CD86) is a costimulatory molecule expressed by antigen-presenting cells (APCs), which interacts with CD28 for T-cell activation and survival and with CTLA4 for immune regulation.

Product Specifications

Product Name Alternative

B7-2/CD86 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-2-cd86-protein-human-hek293-fc.html

Purity

97.00

Smiles

LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

Molecular Formula

942 (Gene_ID) P42081-1 (L20-P247) (Accession)

Molecular Weight

65-80 kDa

References & Citations

[1]Han L, et al. A monoclonal antibody against CD86 and its protection in a murine lupus nephritis model of chronic graft-versus-host disease. Immunopharmacol Immunotoxicol. 2017 Oct;39 (5) :285-291.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prcp Mouse shRNA Lentiviral Particle (Locus ID 72461)
TL504738V 500 µL Each

Prcp Mouse shRNA Lentiviral Particle (Locus ID 72461)

Sign In for Pricing
View Details
ELISA kit for Rat Dynorphin (DYN)
KTE100739-01 48 Tests

ELISA kit for Rat Dynorphin (DYN)

Sign In for Pricing
View Details
ELISA kit for Rat Dynorphin (DYN)
KTE100739-02 96 Tests

ELISA kit for Rat Dynorphin (DYN)

Sign In for Pricing
View Details
ELISA kit for Rat Dynorphin (DYN)
KTE100739-03 5x 96 Well

ELISA kit for Rat Dynorphin (DYN)

Sign In for Pricing
View Details
BRCC3 Protein Vector (Mouse) (pPB-N-His)
PV159807 500 ng

BRCC3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Rat Semaphorin 4A ELISA Kit
MBS076171-01 48 Well

Rat Semaphorin 4A ELISA Kit

Sign In for Pricing
View Details