Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-2/CD86, Human (HEK293, Fc)

B7-2/CD86 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-termimal human IgG1 Fc fragment produced in HEK293 cells. B7-2 (CD86) is a costimulatory molecule expressed by antigen-presenting cells (APCs), which interacts with CD28 for T-cell activation and survival and with CTLA4 for immune regulation.

Product Specifications

Product Name Alternative

B7-2/CD86 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-2-cd86-protein-human-hek293-fc.html

Purity

97.00

Smiles

LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

Molecular Formula

942 (Gene_ID) P42081-1 (L20-P247) (Accession)

Molecular Weight

65-80 kDa

References & Citations

[1]Han L, et al. A monoclonal antibody against CD86 and its protection in a murine lupus nephritis model of chronic graft-versus-host disease. Immunopharmacol Immunotoxicol. 2017 Oct;39 (5) :285-291.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBPJ (IGKJRB, IGKJRB1, RBPJK, RBPSUH, Recombining Binding Protein Suppressor of Hairless, CBF-1, J kappa-recombination Signal-binding Protein, RBP-J kappa, Renal Carcinoma Antigen NY-REN-30, MGC61669) (AP)
MBS6392210-01 0.1 mL

RBPJ (IGKJRB, IGKJRB1, RBPJK, RBPSUH, Recombining Binding Protein Suppressor of Hairless, CBF-1, J kappa-recombination Signal-binding Protein, RBP-J kappa, Renal Carcinoma Antigen NY-REN-30, MGC61669) (AP)

Sign In for Pricing
View Details
RBPJ (IGKJRB, IGKJRB1, RBPJK, RBPSUH, Recombining Binding Protein Suppressor of Hairless, CBF-1, J kappa-recombination Signal-binding Protein, RBP-J kappa, Renal Carcinoma Antigen NY-REN-30, MGC61669) (AP)
MBS6392210-02 5x 0.1 mL

RBPJ (IGKJRB, IGKJRB1, RBPJK, RBPSUH, Recombining Binding Protein Suppressor of Hairless, CBF-1, J kappa-recombination Signal-binding Protein, RBP-J kappa, Renal Carcinoma Antigen NY-REN-30, MGC61669) (AP)

Sign In for Pricing
View Details
Adrenomedullin (16-31), Human
MBS5789213 Inquire

Adrenomedullin (16-31), Human

Sign In for Pricing
View Details
ZNRF2 Protein Vector (Rat) (pPB-N-His)
PV318387 500 ng

ZNRF2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Monoclonal Serpin A1/alpha 1-Antitrypsin Antibody (AAT/1379) [Alexa Fluor 750]
NBP2-54442AF750 0.1 mL

Mouse Monoclonal Serpin A1/alpha 1-Antitrypsin Antibody (AAT/1379) [Alexa Fluor 750]

Sign In for Pricing
View Details
BAK1P1 3'UTR GFP Stable Cell Line
TU051627 1.0 mL

BAK1P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details