Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-2/CD86, Human (HEK293, Fc)

B7-2/CD86 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-termimal human IgG1 Fc fragment produced in HEK293 cells. B7-2 (CD86) is a costimulatory molecule expressed by antigen-presenting cells (APCs), which interacts with CD28 for T-cell activation and survival and with CTLA4 for immune regulation.

Product Specifications

Product Name Alternative

B7-2/CD86 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-2-cd86-protein-human-hek293-fc.html

Purity

97.00

Smiles

LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

Molecular Formula

942 (Gene_ID) P42081-1 (L20-P247) (Accession)

Molecular Weight

65-80 kDa

References & Citations

[1]Han L, et al. A monoclonal antibody against CD86 and its protection in a murine lupus nephritis model of chronic graft-versus-host disease. Immunopharmacol Immunotoxicol. 2017 Oct;39 (5) :285-291.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SERCA2 ATPase Antibody [mFluor Violet 500 SE]
NBP2-97582MFV500 0.1 mL

Rabbit Polyclonal SERCA2 ATPase Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Cortisone (OVA)
abx165682-01 100 µg

Cortisone (OVA)

Sign In for Pricing
View Details
Cortisone (OVA)
abx165682-02 200 µg

Cortisone (OVA)

Sign In for Pricing
View Details
Cortisone (OVA)
abx165682-03 500 µg

Cortisone (OVA)

Sign In for Pricing
View Details
Cortisone (OVA)
abx165682-04 1 mg

Cortisone (OVA)

Sign In for Pricing
View Details
Cortisone (OVA)
abx165682-05 5 mg

Cortisone (OVA)

Sign In for Pricing
View Details