Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-2/CD86, Human (HEK293, Fc)

B7-2/CD86 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-termimal human IgG1 Fc fragment produced in HEK293 cells. B7-2 (CD86) is a costimulatory molecule expressed by antigen-presenting cells (APCs), which interacts with CD28 for T-cell activation and survival and with CTLA4 for immune regulation.

Product Specifications

Product Name Alternative

B7-2/CD86 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-2-cd86-protein-human-hek293-fc.html

Purity

97.00

Smiles

LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

Molecular Formula

942 (Gene_ID) P42081-1 (L20-P247) (Accession)

Molecular Weight

65-80 kDa

References & Citations

[1]Han L, et al. A monoclonal antibody against CD86 and its protection in a murine lupus nephritis model of chronic graft-versus-host disease. Immunopharmacol Immunotoxicol. 2017 Oct;39 (5) :285-291.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSSK2 Human siRNA Oligo Duplex (Locus ID 23617)
SR308405 1 Kit

TSSK2 Human siRNA Oligo Duplex (Locus ID 23617)

Sign In for Pricing
View Details
PARP16 ORF Vector (Human) (pORF)
ORF007529 1.0 µg DNA

PARP16 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
MAb to Canine Parvovirus
MBS310352-01 1 mg

MAb to Canine Parvovirus

Sign In for Pricing
View Details
MAb to Canine Parvovirus
MBS310352-02 5x 1 mg

MAb to Canine Parvovirus

Sign In for Pricing
View Details
Recombinant Human PCSK9 protein (His tag)
MBS2571394-01 0.02 mg

Recombinant Human PCSK9 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PCSK9 protein (His tag)
MBS2571394-02 0.1 mg

Recombinant Human PCSK9 protein (His tag)

Sign In for Pricing
View Details