Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine viral diarrhea virus Genome polyprotein , partial

Product Specifications

Product Name Alternative

Genome polyprotein [Cleaved into: N-terminal protease; N-pro; EC 3.4.22.-; Autoprotease p20) ; Capsid protein C; E (rns) glycoprotein; gp44/48) ; Envelope glycoprotein E1; gp33) ; Envelope glycoprotein E2; gp55) ; p7; Non-structural protein 2-3; Cysteine protease NS2; EC 3.4.22.-; Non-structural protein 2) ; Serine protease NS3; EC 3.4.21.113; EC 3.6.1.15; EC 3.6.4.13; Non-structural protein 3) ; Non-structural protein 4A; NS4A) ; Non-structural protein 4B; NS4B) ; Non-structural protein 5A; NS5A) ; RNA-directed RNA polymerase; EC 2.7.7.48; NS5B) ]

Abbreviation

Recombinant Bovine viral diarrhea virus Genome polyprotein protein, partial

UniProt

Q01499

Expression Region

1-168aa

Organism

Bovine viral diarrhea virus (strain SD-1) (BVDV) (Mucosal disease virus)

Target Sequence

MELITNELLYKTYKQKPVGVEEPVYDQAGNPLFGERGAIHPQSTLKLPHKRGERNVPTSLASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYICIDGCITVKSATRSHQRVLRWVHNRLDCPLWVTSC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Initial binding to target cell probably involves interaction of E with glycosaminoglycans. E1 and/or E2 are responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.4 kDa

References & Citations

"Structure of a pestivirus envelope glycoprotein E2 clarifies its role in cell entry." El Omari K., Iourin O., Harlos K., Grimes J.M., Stuart D.I. Cell Rep 3:30-35 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-100 1x 100 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-500 1x 500 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details