Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP-15, Human (His, Myc)

Bone morphogenetic protein 15 (BMP-15; GDF9B), also known as growth differentiation factor 9B (GDF9B), is a polymorphic ligand protein of the TGFβ family and is only expressed in follicular cells. BMP15 is closely related to GDF9 and synergistically regulates the genetic development of follicles. BMP15 is involved in p38 MAPK and HIF-1α/SCF signaling pathway, respectively, and can up-regulate the expression of anti-Mullerian hormone (AMH) and polycystic ovarian syndrome (PCOS) related stem cell factor (SCF) in granulosa cells.

Product Specifications

Product Name Alternative

BMP-15 Protein, Human (His, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmp15-protein-human-his-myc.html

Purity

97.00

Smiles

QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR

Molecular Formula

9210 (Gene_ID) O95972 (Q268-R392) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Galloway SM, et al. Bmp15 mutations and ovarian function. Mol Cell Endocrinol. 2002 May 31;191 (1) :15-8.|[2]Liu MN, et al. The role of BMP15 and GDF9 in the pathogenesis of primary ovarian insufficiency. Hum Fertil (Camb) . 2021 Dec;24 (5) :325-332.|[3]Zhao Z, et al. BMP15 regulates AMH expression via the p38 MAPK pathway in granulosa cells from goat. Theriogenology. 2018 Sep 15;118:72-79.|[4]Cao LY, et al. Aberrant BMP15/HIF-1α/SCF signaling pathway in human granulosa cells is involved in the PCOS related abnormal follicular development. Gynecol Endocrinol. 2022 Sep 23:1-7.|[5]Shimizu K, et al. Molecular mechanism of FSHR expression induced by BMP15 in human granulosa cells. J Assist Reprod Genet. 2019 Jun;36 (6) :1185-1194.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PDHA1 Mouse Monoclonal Antibody [Clone ID: OTI2C10]
TA502696S 30 µL

PDHA1 Mouse Monoclonal Antibody [Clone ID: OTI2C10]

Ask
View Details
AdmiRa-mmu-mir-692-1 Virus
mm0600 1.0 mL

AdmiRa-mmu-mir-692-1 Virus

Ask
View Details
Rat Calprotectin ELISA Kit
abx055173-01 96 Tests

Rat Calprotectin ELISA Kit

Ask
View Details
Rat Calprotectin ELISA Kit
abx055173-02 5x 96 Tests

Rat Calprotectin ELISA Kit

Ask
View Details
Rat Calprotectin ELISA Kit
abx055173-03 10x 96 Tests

Rat Calprotectin ELISA Kit

Ask
View Details
1-Benzoylpiperazine
HY-W002698 5 g

1-Benzoylpiperazine

Ask
View Details