Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2A, Human (HEK293, His)

AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Human (HEK293, His) is the recombinant human-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMY2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amy2a-protein-human-hek293-his.html

Purity

95.00

Smiles

QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Molecular Formula

279 (Gene_ID) P04746 (Q16-L511) (Accession)

Molecular Weight

53-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf168 (FAXC) Rabbit Polyclonal Antibody
TA359022 100 µL

C6orf168 (FAXC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Lactobacillus johnsonii ATP synthase gamma chain (atpG)
MBS1409138-01 0.02 mg (E-Coli)

Recombinant Lactobacillus johnsonii ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Lactobacillus johnsonii ATP synthase gamma chain (atpG)
MBS1409138-02 0.02 mg (Yeast)

Recombinant Lactobacillus johnsonii ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Lactobacillus johnsonii ATP synthase gamma chain (atpG)
MBS1409138-03 0.1 mg (E-Coli)

Recombinant Lactobacillus johnsonii ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Lactobacillus johnsonii ATP synthase gamma chain (atpG)
MBS1409138-04 0.1 mg (Yeast)

Recombinant Lactobacillus johnsonii ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Lactobacillus johnsonii ATP synthase gamma chain (atpG)
MBS1409138-05 0.02 mg (Baculovirus)

Recombinant Lactobacillus johnsonii ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details