Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2A, Human (HEK293, His)

AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Human (HEK293, His) is the recombinant human-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMY2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amy2a-protein-human-hek293-his.html

Purity

95.00

Smiles

QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Molecular Formula

279 (Gene_ID) P04746 (Q16-L511) (Accession)

Molecular Weight

53-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lyrm1 (NM_001285961) Mouse Untagged Clone
MC225751 10 µg

Lyrm1 (NM_001285961) Mouse Untagged Clone

Sign In for Pricing
View Details
ATP5SL 3'UTR GFP Stable Cell Line
TU051441 1.0 mL

ATP5SL 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
pLV3-U6-ME2-shRNA1-Fluc-Puro Plasmid
PVT59090 2 µg

pLV3-U6-ME2-shRNA1-Fluc-Puro Plasmid

Sign In for Pricing
View Details
Melatonin Receptor 1B (MTNR1B) (NM_005959) Human Tagged ORF Clone Lentiviral Particle
RC216445L3V 200 µL

Melatonin Receptor 1B (MTNR1B) (NM_005959) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Radx shRNA (UAS) - Lentiviral mouse Radx shRNA (UAS, GFP) plasmid
GTR15185842 1 Vial

Lentiviral mouse Radx shRNA (UAS) - Lentiviral mouse Radx shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human NRG2 (Neuregulin 2) ELISA Kit
MBS8802346-01 48 Well

Human NRG2 (Neuregulin 2) ELISA Kit

Sign In for Pricing
View Details