Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2A, Human (HEK293, His)

AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Human (HEK293, His) is the recombinant human-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMY2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amy2a-protein-human-hek293-his.html

Purity

95.00

Smiles

QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Molecular Formula

279 (Gene_ID) P04746 (Q16-L511) (Accession)

Molecular Weight

53-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (6- Aminohexylamino) adenosine- 3', 5'- cyclic monophosphate; immobilized on agarose gel (2-AHA-cAMP-Agarose)
A 054-06 0.6 mL

2- (6- Aminohexylamino) adenosine- 3', 5'- cyclic monophosphate; immobilized on agarose gel (2-AHA-cAMP-Agarose)

Sign In for Pricing
View Details
Demeton O&S
sc-257305 100 mg

Demeton O&S

Sign In for Pricing
View Details
GFP hsa-mir-4674 AAV miRNA Vector
Amh1133600 500 ng

GFP hsa-mir-4674 AAV miRNA Vector

Sign In for Pricing
View Details
β-Amyloid, NT (MaxLight 550) discontinued
A2275-73D-ML550 100 µL

β-Amyloid, NT (MaxLight 550) discontinued

Sign In for Pricing
View Details
PI3 Kinase p85 alpha Rabbit pAb
E45R17285N-100 100 µL

PI3 Kinase p85 alpha Rabbit pAb

Sign In for Pricing
View Details
Rabbit anti-CD48 Antibody, Affinity Purified
MBS3904618-01 0.01 mg

Rabbit anti-CD48 Antibody, Affinity Purified

Sign In for Pricing
View Details