Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2A, Human (HEK293, His)

AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Human (HEK293, His) is the recombinant human-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMY2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amy2a-protein-human-hek293-his.html

Purity

95.00

Smiles

QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Molecular Formula

279 (Gene_ID) P04746 (Q16-L511) (Accession)

Molecular Weight

53-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human C16orf13, His-tagged
C16orf13-10405H 25 µg

Recombinant Human C16orf13, His-tagged

Sign In for Pricing
View Details
Rabbit Polyclonal LRFN5 Antibody [DyLight 550]
NBP1-77004R 0.1 mL

Rabbit Polyclonal LRFN5 Antibody [DyLight 550]

Sign In for Pricing
View Details
PKMYT1 Antibody
A14718-100UG 100 µg

PKMYT1 Antibody

Sign In for Pricing
View Details
Mouse Receptor-type tyrosine-protein phosphatase F ELISA Kit
MBS288861-01 48 Well

Mouse Receptor-type tyrosine-protein phosphatase F ELISA Kit

Sign In for Pricing
View Details
Mouse Receptor-type tyrosine-protein phosphatase F ELISA Kit
MBS288861-02 96 Well

Mouse Receptor-type tyrosine-protein phosphatase F ELISA Kit

Sign In for Pricing
View Details
Mouse Receptor-type tyrosine-protein phosphatase F ELISA Kit
MBS288861-03 5x 96 Well

Mouse Receptor-type tyrosine-protein phosphatase F ELISA Kit

Sign In for Pricing
View Details