Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2A, Human (HEK293, His)

AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Human (HEK293, His) is the recombinant human-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMY2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amy2a-protein-human-hek293-his.html

Purity

95.00

Smiles

QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Molecular Formula

279 (Gene_ID) P04746 (Q16-L511) (Accession)

Molecular Weight

53-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTSL5 Protein Vector (Rat) (pPM-C-HA)
PV252304 500 ng

ADAMTSL5 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Candida Albicans SAP2 Protein (aa 57-398) (strain SC5314 / ATCC MYA-2876)
VAng-Lsx05916-500gEcoli 500 µg (E. coli)

Recombinant Candida Albicans SAP2 Protein (aa 57-398) (strain SC5314 / ATCC MYA-2876)

Sign In for Pricing
View Details
hsa-miR-525-5p miRNA Antagomir
MNH02945 2x 5.0 nmol

hsa-miR-525-5p miRNA Antagomir

Sign In for Pricing
View Details
TPRG1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
47390156 3x 1.0 µg DNA

TPRG1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
MARCKSL1 Recombinant Protein (Human)
RP018835 100 µg

MARCKSL1 Recombinant Protein (Human)

Sign In for Pricing
View Details
pth Antibody; FITC conjugated
MBS7003277-01 0.05 mg

pth Antibody; FITC conjugated

Sign In for Pricing
View Details