Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2A, Human (HEK293, His)

AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Human (HEK293, His) is the recombinant human-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMY2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amy2a-protein-human-hek293-his.html

Purity

95.00

Smiles

QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Molecular Formula

279 (Gene_ID) P04746 (Q16-L511) (Accession)

Molecular Weight

53-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED28 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV686769 1.0 µg DNA

MED28 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Petroleum ether 40 - 60 Residue
sc-286648 2.5 L

Petroleum ether 40 - 60 Residue

Sign In for Pricing
View Details
CBR1 (NM_001757) Human Over-expression Lysate
LY400669 100 µg

CBR1 (NM_001757) Human Over-expression Lysate

Sign In for Pricing
View Details
AGFG1 Human siRNA Oligo Duplex (Locus ID 3267)
SR302228 1 Kit

AGFG1 Human siRNA Oligo Duplex (Locus ID 3267)

Sign In for Pricing
View Details
C3, Fab’2 (Complement C3, AHUS5, ARMD9, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1, CPAMD1, ASP) (MaxLight 650) discontinued
137574-ML650 100 µL

C3, Fab’2 (Complement C3, AHUS5, ARMD9, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1, CPAMD1, ASP) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Human SSU72 siRNA
abx905301-01 15 nmol

Human SSU72 siRNA

Sign In for Pricing
View Details