Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2A, Human (HEK293, His)

AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Human (HEK293, His) is the recombinant human-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMY2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amy2a-protein-human-hek293-his.html

Purity

95.00

Smiles

QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Molecular Formula

279 (Gene_ID) P04746 (Q16-L511) (Accession)

Molecular Weight

53-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gins3 Mouse shRNA Plasmid (Locus ID 78833)
TL505303 1 Kit

Gins3 Mouse shRNA Plasmid (Locus ID 78833)

Sign In for Pricing
View Details
C21orf2 (Protein C21orf2, C21orf-HUMF09G8.5, YF5/A2)
124120 100 µg

C21orf2 (Protein C21orf2, C21orf-HUMF09G8.5, YF5/A2)

Sign In for Pricing
View Details
TMEM65 3'UTR Luciferase Stable Cell Line
TU025773 1.0 mL

TMEM65 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Fhl2 shRNA (UAS) - Lentiviral mouse Fhl2 shRNA (UAS) (25)
GTR15236945 1 Vial

Lentiviral mouse Fhl2 shRNA (UAS) - Lentiviral mouse Fhl2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Smr2l Mouse qPCR Primer Pair (NM_001110779)
MP219483 200 Reactions

Smr2l Mouse qPCR Primer Pair (NM_001110779)

Sign In for Pricing
View Details
Elf5 (NM_001145813) Mouse Tagged ORF Clone Lentiviral Particle
MR217599L3V 200 µL

Elf5 (NM_001145813) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details