Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2A, Human (HEK293, His)

AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Human (HEK293, His) is the recombinant human-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMY2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amy2a-protein-human-hek293-his.html

Purity

95.00

Smiles

QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Molecular Formula

279 (Gene_ID) P04746 (Q16-L511) (Accession)

Molecular Weight

53-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TUBA3FP (NM_145042) AAV Particle
RC203663A1V 250 µL

Human TUBA3FP (NM_145042) AAV Particle

Sign In for Pricing
View Details
3′-O-Azidomethyl-dATP – Solution, S pack
JBS-NU-1227S 100 µL

3′-O-Azidomethyl-dATP – Solution, S pack

Sign In for Pricing
View Details
PCMV6-TMEM131-3*FLAG
BZ66946 1 Vial

PCMV6-TMEM131-3*FLAG

Sign In for Pricing
View Details
Phospho-RPA2-S4/S8 polyclonal antibody
BS79480-01 50 µL

Phospho-RPA2-S4/S8 polyclonal antibody

Sign In for Pricing
View Details
Phospho-RPA2-S4/S8 polyclonal antibody
BS79480-02 100 µL

Phospho-RPA2-S4/S8 polyclonal antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae MSS51 Protein (aa 27-436) [His]
VAng-Wyb5111-1mg 1 mg

Recombinant Saccharomyces Cerevisiae MSS51 Protein (aa 27-436) [His]

Sign In for Pricing
View Details