Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2A, Human (HEK293, His)

AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Human (HEK293, His) is the recombinant human-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMY2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amy2a-protein-human-hek293-his.html

Purity

95.00

Smiles

QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Molecular Formula

279 (Gene_ID) P04746 (Q16-L511) (Accession)

Molecular Weight

53-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-MCM2 Recombinant Antibody (MOB-0102F)
MOB-0102F Each

Mouse Anti-MCM2 Recombinant Antibody (MOB-0102F)

Sign In for Pricing
View Details
ZNF10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
51291061 1.0 µg DNA

ZNF10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
OSBPL5 (NM_020896) Human Tagged Lenti ORF Clone
RC208025L1 10 µg

OSBPL5 (NM_020896) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
VWC2L-set siRNA/shRNA/RNAi Lentivector (Human)
50242091 4x 500 ng

VWC2L-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
KRTAP3-2 Protein Vector (Mouse) (pPB-C-His)
PV195506 500 ng

KRTAP3-2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
DKC1 Antibody / Dyskerin
FY13179 100 µg

DKC1 Antibody / Dyskerin

Sign In for Pricing
View Details