Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2A, Human (HEK293, His)

AMY2A is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2A plays an important role in digesting dietary starch, and inhibiting AMY2A can lead to a decrease in postprandial blood glucose levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Human (HEK293, His) is the recombinant human-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMY2A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amy2a-protein-human-hek293-his.html

Purity

95.00

Smiles

QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Molecular Formula

279 (Gene_ID) P04746 (Q16-L511) (Accession)

Molecular Weight

53-58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IgG2A Fc Recombinant Protein Tag Free Lyophilized
MBS8434532-01 0.05 mg

Rat IgG2A Fc Recombinant Protein Tag Free Lyophilized

Sign In for Pricing
View Details
Rat IgG2A Fc Recombinant Protein Tag Free Lyophilized
MBS8434532-02 5x 0.05 mg

Rat IgG2A Fc Recombinant Protein Tag Free Lyophilized

Sign In for Pricing
View Details
FABP3 antibody - middle region
MBS3208595-01 0.1 mL

FABP3 antibody - middle region

Sign In for Pricing
View Details
FABP3 antibody - middle region
MBS3208595-02 5x 0.1 mL

FABP3 antibody - middle region

Sign In for Pricing
View Details
Recombinant Canine Adenovirus Serotype 1 E1B 55 kDa Protein
VG2C105-01 1 mg

Recombinant Canine Adenovirus Serotype 1 E1B 55 kDa Protein

Sign In for Pricing
View Details
Recombinant Canine Adenovirus Serotype 1 E1B 55 kDa Protein
VG2C105-02 100 µg

Recombinant Canine Adenovirus Serotype 1 E1B 55 kDa Protein

Sign In for Pricing
View Details