Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial (Active)

Product Specifications

Product Name Alternative

TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP; latency-associated peptide; TGFbeta; TGF-beta 1 protein; transforming growth factor beta-1

Abbreviation

Recombinant Mouse Tgfb1 protein, partial (Active)

Gene Name

Tgfb1

UniProt

P04202

Expression Region

279-390aa

Organism

Mus musculus (Mouse)

Target Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Transforming growth factor beta 1 (TGFβ1) is the prototype of a growing superfamily of peptide growth factors and plays a prominent role in a variety of cellular processes, including cell-cycle progression, cell differentiation, reproductive function, development, motility, adhesion, neuronal growth, bone morphogenesis, wound healing, and immune surveillance. TGF-β1, TGF-β2 and TGF-β3 signal via the same heteromeric receptor complex, consisting of a ligand binding TGF-β receptor type II (TβR-II), and a TGF-β receptor type I (TβR-I) . Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF-β expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 5-25 pg/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 4 mM HCl

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts

Molecular Weight

12.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human CENPM protein
ATGP4075-010 10 µg

Recombinant human CENPM protein

Sign In for Pricing
View Details
NRM Protein Lysate (Mouse) with C-HA Tag
32174034 100 µg

NRM Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
SNTN (NM_001080537) Human Mass Spec Standard
PH314753 10 µg

SNTN (NM_001080537) Human Mass Spec Standard

Sign In for Pricing
View Details
C5orf28 Protein Vector (Human) (pPB-His-GST)
PV331271 500 ng

C5orf28 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Human FAM78A Pre-designed siRNA Set B
SI005436B 1 Each

Human FAM78A Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral human NFKB2 shRNA (UAS) - Lentiviral human NFKB2 shRNA (UAS) plasmid
GTR15134035 1 Vial

Lentiviral human NFKB2 shRNA (UAS) - Lentiviral human NFKB2 shRNA (UAS) plasmid

Sign In for Pricing
View Details