Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial

Product Specifications

Product Name Alternative

Triggering receptor expressed on monocytes 2

Abbreviation

Recombinant Human TREM2 protein, partial

Gene Name

TREM2

UniProt

Q9NZC2

Expression Region

19-174aa

Organism

Homo sapiens (Human)

Target Sequence

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP36L1 Rabbit pAb, BF700 conjugated
orb2840488 100 µL

ZFP36L1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O1:K1/APEC HLDE Polyclonal Antibody
MBS7167365 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC HLDE Polyclonal Antibody

Sign In for Pricing
View Details
CYP2C18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0550706 1.0 µg DNA

CYP2C18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Monoclonal IL-2 R beta Antibody (5H4) [Janelia Fluor 549]
NBP3-12040JF549 0.1 mL

Rabbit Monoclonal IL-2 R beta Antibody (5H4) [Janelia Fluor 549]

Sign In for Pricing
View Details
TMEM79 (NM_032323) Human Tagged Lenti ORF Clone
RC202998L3 10 µg

TMEM79 (NM_032323) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
STK10 Polyclonal Antibody
MBS2573459-01 0.06 mL

STK10 Polyclonal Antibody

Sign In for Pricing
View Details