Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTCD, Human (sf9, His)

The FTCD protein is a folate-dependent enzyme with dual functions of transferase and deaminase activities. It plays a crucial role in directing the one-carbon units from methyliminoglutamic acid into the folate pool, contributing to the regulation of folate metabolism. FTCD Protein, Human (sf9, His) is the recombinant human-derived FTCD protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

FTCD Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ftcd-protein-human-sf9-his.html

Purity

95.20

Smiles

MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Molecular Formula

10841 (Gene_ID) O95954-1 (M1-E541) (Accession)

Molecular Weight

Approximately 60.4 kDa.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF640R conjugate, 0.1mg/mL
BNC403526-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat Ubiquitin (Ub) ELISA Kit
RDR-Ub-Ra-01 96 Tests

Rat Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
Rat Ubiquitin (Ub) ELISA Kit
RDR-Ub-Ra-02 48 Tests

Rat Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
Bcs1l Mouse Gene Knockout Kit (CRISPR)
KN502123 1 Kit

Bcs1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS508783 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
CTBP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D4]
TA807909BM 100 µL

CTBP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D4]

Sign In for Pricing
View Details