Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTCD, Human (sf9, His)

The FTCD protein is a folate-dependent enzyme with dual functions of transferase and deaminase activities. It plays a crucial role in directing the one-carbon units from methyliminoglutamic acid into the folate pool, contributing to the regulation of folate metabolism. FTCD Protein, Human (sf9, His) is the recombinant human-derived FTCD protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

FTCD Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ftcd-protein-human-sf9-his.html

Purity

95.20

Smiles

MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Molecular Formula

10841 (Gene_ID) O95954-1 (M1-E541) (Accession)

Molecular Weight

Approximately 60.4 kDa.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Olivetolate
TRC-E388620-5G 5 g

Ethyl Olivetolate

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF594 conjugate, 0.1mg/mL
BNC942406-500 1x 500 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CREBRF (NM_001168393) Human Over-expression Lysate
LC433041 20 µg

CREBRF (NM_001168393) Human Over-expression Lysate

Sign In for Pricing
View Details
GGCX Rabbit Polyclonal Antibody
TA369141 100 µL

GGCX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Optional tube holder, 12x5ml tubes
D2400-R5V2 1 Each

Optional tube holder, 12x5ml tubes

Sign In for Pricing
View Details
NAGA (NM_000262) Human Over-expression Lysate
LC400100 20 µg

NAGA (NM_000262) Human Over-expression Lysate

Sign In for Pricing
View Details