Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTCD, Human (sf9, His)

The FTCD protein is a folate-dependent enzyme with dual functions of transferase and deaminase activities. It plays a crucial role in directing the one-carbon units from methyliminoglutamic acid into the folate pool, contributing to the regulation of folate metabolism. FTCD Protein, Human (sf9, His) is the recombinant human-derived FTCD protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

FTCD Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ftcd-protein-human-sf9-his.html

Purity

95.20

Smiles

MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Molecular Formula

10841 (Gene_ID) O95954-1 (M1-E541) (Accession)

Molecular Weight

Approximately 60.4 kDa.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM43B Antibody
OC-2236-01 50 μL

TRIM43B Antibody

Sign In for Pricing
View Details
TRIM43B Antibody
OC-2236-02 100 µL

TRIM43B Antibody

Sign In for Pricing
View Details
TRIM43B Antibody
OC-2236-03 1 mL

TRIM43B Antibody

Sign In for Pricing
View Details
Cerivastatin Sodium Salt
TRC-C277000-25MG 25 mg

Cerivastatin Sodium Salt

Sign In for Pricing
View Details
Anti-IFN Beta (HDB-4A7) In Vivo Antibody - Low Endotoxin
ICH1110-100mg 100 mg

Anti-IFN Beta (HDB-4A7) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
ZNF596 Human qPCR Primer Pair (NM_001042416)
HP232860 200 Reactions

ZNF596 Human qPCR Primer Pair (NM_001042416)

Sign In for Pricing
View Details