Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTCD, Human (sf9, His)

The FTCD protein is a folate-dependent enzyme with dual functions of transferase and deaminase activities. It plays a crucial role in directing the one-carbon units from methyliminoglutamic acid into the folate pool, contributing to the regulation of folate metabolism. FTCD Protein, Human (sf9, His) is the recombinant human-derived FTCD protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

FTCD Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ftcd-protein-human-sf9-his.html

Purity

95.20

Smiles

MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Molecular Formula

10841 (Gene_ID) O95954-1 (M1-E541) (Accession)

Molecular Weight

Approximately 60.4 kDa.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMCA4 HDR Plasmid (h)
sc-402888-HDR 20 µg

PMCA4 HDR Plasmid (h)

Sign In for Pricing
View Details
Lentiviral human MCM10 shRNA (UAS) - Lentiviral human MCM10 shRNA (UAS, RFP) plasmid
GTR15328948 1 Vial

Lentiviral human MCM10 shRNA (UAS) - Lentiviral human MCM10 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
LACTB Lentiviral Activation Particles (h2)
sc-414033-LAC-2 200 µL

LACTB Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
G3BP Rabbit mAb Antibody
orb3015417 100 µL

G3BP Rabbit mAb Antibody

Sign In for Pricing
View Details
Mouse T-cell surface glycoprotein CD3 epsilon chain (CD3E) ELISA Kit
MBS7215909-01 48 Well

Mouse T-cell surface glycoprotein CD3 epsilon chain (CD3E) ELISA Kit

Sign In for Pricing
View Details
Mouse T-cell surface glycoprotein CD3 epsilon chain (CD3E) ELISA Kit
MBS7215909-02 96 Well

Mouse T-cell surface glycoprotein CD3 epsilon chain (CD3E) ELISA Kit

Sign In for Pricing
View Details