Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus A Non-structural glycoprotein 4, partial

Product Specifications

Product Name Alternative

NSP4; NCVP5; NS28

Abbreviation

Recombinant Rotavirus A Non-structural glycoprotein 4 protein, partial

UniProt

P04512

Expression Region

52-175aa

Organism

Rotavirus A (strain RVA/SA11-Both/G3P5B[2]) (RV-A) (Simian Agent 11 (strain Both) )

Target Sequence

PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGKNPYEPREVTAAM

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Plays an essential role in the virus replication cycle by acting as a viroporin. Creates a pore in the host reticulum endoplasmic and as a consequence releases Ca (2+) in the cytoplasm of infected cell. In turn, high levels of cytoplasmic calcium trigger membrane trafficking and transport of viral ER-associated proteins to viroplasms, sites of viral genome replication and immature particle assembly. ; The secreted form acts as an enterotoxin that causes phospholipase C-dependent elevation of the intracellular calcium concentration in host intestinal mucosa cells. Increased concentration of intracellular calcium disrupts the cytoskeleton and the tight junctions, raising the paracellular permeability. Potentiates chloride ion secretion through a calcium ion-dependent signaling pathway, inducing age-dependent diarrhea. To perform this enterotoxigenic role in vivo, NSP4 is released from infected enterocytes in a soluble form capable of diffusing within the intestinal lumen and interacting with host plasma membrane receptors on neighboring epithelial cells such as integrins ITGA1/ITGB1 and ITGA2/ITGB1.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAN1 CRISPR Activation Plasmid (m)
sc-436189-ACT 20 µg

MAN1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
UCHL5IP Polyclonal Antibody
orb1416886 100 µL

UCHL5IP Polyclonal Antibody

Sign In for Pricing
View Details
COX7A3 Rabbit pAb
E47R14013 100 µL

COX7A3 Rabbit pAb

Sign In for Pricing
View Details
N-Boc Di-2- (Hydroxyphenyl) acetamido Cefprozil tert-Butyldimethylsilyl Ether
458231-01 5 mg

N-Boc Di-2- (Hydroxyphenyl) acetamido Cefprozil tert-Butyldimethylsilyl Ether

Sign In for Pricing
View Details
N-Boc Di-2- (Hydroxyphenyl) acetamido Cefprozil tert-Butyldimethylsilyl Ether
458231-02 10 mg

N-Boc Di-2- (Hydroxyphenyl) acetamido Cefprozil tert-Butyldimethylsilyl Ether

Sign In for Pricing
View Details
Adcy10 3'UTR Lenti-reporter-Luc Vector
11392086 1.0 µg

Adcy10 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details