Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Heat shock protein 60, mitochondrial (HSP60), partial

Product Specifications

Product Name Alternative

(CPN60) (P66) (Stimulator factor I 66 kDa component)

Abbreviation

Recombinant Saccharomyces cerevisiae HSP60 protein, partial

Gene Name

HSP60

UniProt

P19882

Expression Region

156-435aa

Organism

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Target Sequence

KKEITTSEEIAQVATISANGDSHVGKLLASAMEKVGKEGVITIREGRTLEDELEVTEGMRFDRGFISPYFITDPKSSKVEFEKPLLLLSEKKISSIQDILPALEISNQSRRPLLIIAEDVDGEALAACILNKLRGQVKVCAVKAPGFGDNRKNTIGDIAVLTGGTVFTEELDLKPEQCTIENLGSCDSITVTKEDTVILNGSGPKEAIQERIEQIKGSIDITTTNSYEKEKLQERLAKLSGGVAVIRVGGASEVEVGEKKDRYDDALNATRAAVEEGILP

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

May participate in assembly and/or disassembly of proteins imported into the mitochondrion. HSP60 are ATPases and have affinity for unfolded proteins.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.8 kDa

References & Citations

"Global landscape of protein complexes in the yeast Saccharomyces cerevisiae." Krogan N.J., Cagney G., Yu H., Zhong G., Guo X., Ignatchenko A., Li J., Pu S., Datta N., Tikuisis A.P., Punna T., Peregrin-Alvarez J.M., Shales M., Zhang X., Davey M., Robinson M.D., Paccanaro A., Bray J.E. Greenblatt J.F. Nature 440:637-643 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Olfactory receptor 1J4, OR1J4 ELISA KIT
ELI-46357h 96 Tests

Human Olfactory receptor 1J4, OR1J4 ELISA KIT

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 5 Like Protein (LRP5L)
MBS2085611-01 0.1 mL

PE-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 5 Like Protein (LRP5L)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 5 Like Protein (LRP5L)
MBS2085611-02 0.2 mL

PE-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 5 Like Protein (LRP5L)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 5 Like Protein (LRP5L)
MBS2085611-03 0.5 mL

PE-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 5 Like Protein (LRP5L)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 5 Like Protein (LRP5L)
MBS2085611-04 1 mL

PE-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 5 Like Protein (LRP5L)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 5 Like Protein (LRP5L)
MBS2085611-05 5 mL

PE-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 5 Like Protein (LRP5L)

Sign In for Pricing
View Details