Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-2R gamma/CD132, Mouse (HEK293, His)

IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2. IL-2R gamma takes part in inflammatory response and mediates activation of the cells [1][2]. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[3]. IL-2R gamma/CD132 Protein, Mouse (HEK293, His) is a recombinant mice extracellular region of IL-2R gamma with a C-Terminal 6*His tag, which is produced in HEK293 cells.

Product Specifications

Product Name Alternative

IL-2R gamma/CD132 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-2r-gamma-cd132-protein-mouse-239a-a-hek293-his.html

Purity

95.0

Smiles

SKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEA

Molecular Formula

16186 (Gene_ID) Q3UPA9 (S25-A263) (Accession)

Molecular Weight

50-75 kDa

References & Citations

[1]X Cao, et al. Characterization of cDNAs encoding the murine interleukin 2 receptor (IL-2R) gamma chain: chromosomal mapping and tissue specificity of IL-2R gamma chain expression. Proc Natl Acad Sci U S A. 1993 Sep 15;90 (18) :8464-8.|[2]S Hodge, et al. Surface and intracellular interleukin-2 receptor expression on various resting and activated populations involved in cell-mediated immunity in human peripheral blood. Scand J Immunol. 2000 Jan;51 (1) :67-72.|[3]W P Weidanz, et al. Signalling through the IL-2 receptor γ (c) peptide (CD132) is essential for the expression of immunity to Plasmodium chabaudi adami blood-stage malaria.|[4]J P DiSanto, et al. Lymphoid development in mice with a targeted deletion of the interleukin 2 receptor gamma chain. Proc Natl Acad Sci U S A. 1995 Jan 17;92 (2) :377-81.|[5]Leonard D Shultz, et al. Humanized NOD/LtSz-scid IL2 receptor common gamma chain knockout mice in diabetes research. Ann N Y Acad Sci. 2007 Apr;1103:77-89.|[6]Mengmeng Zhao, et al. Expression of Interleukin-2 receptor subunit gamma (IL-2Rγ) and its binding with IL-2 induced activation of CD4 T lymphocytes in flounder (Paralichthys olivaceus) . Fish Shellfish Immunol. 2022 Mar;122:426-436.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBP1 (16H5) Mouse Monoclonal antibody
E28PE1358 100 µL

GBP1 (16H5) Mouse Monoclonal antibody

Sign In for Pricing
View Details
LIM2, CT (LIM2, Lens fiber membrane intrinsic protein, MP18, MP19, MP20) (MaxLight 550) discontinued
037780-ML550 100 µL

LIM2, CT (LIM2, Lens fiber membrane intrinsic protein, MP18, MP19, MP20) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Influenza A Virus Matrix Protein Antibody (1G1A12) [FITC]
NBP2-50480F 0.1 mL

Mouse Monoclonal Influenza A Virus Matrix Protein Antibody (1G1A12) [FITC]

Sign In for Pricing
View Details
TAF9B Protein Vector (Human) (pPM-C-HA)
46094021 500 ng

TAF9B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Nfia (NM_001122953) Mouse Untagged Clone
MC216272 10 µg

Nfia (NM_001122953) Mouse Untagged Clone

Sign In for Pricing
View Details
Mageb7-ps Mouse shRNA Lentiviral Particle (Locus ID 637027)
TL518480V 500 µL Each

Mageb7-ps Mouse shRNA Lentiviral Particle (Locus ID 637027)

Sign In for Pricing
View Details