Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-2R gamma/CD132, Mouse (HEK293, His)

IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2. IL-2R gamma takes part in inflammatory response and mediates activation of the cells [1][2]. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[3]. IL-2R gamma/CD132 Protein, Mouse (HEK293, His) is a recombinant mice extracellular region of IL-2R gamma with a C-Terminal 6*His tag, which is produced in HEK293 cells.

Product Specifications

Product Name Alternative

IL-2R gamma/CD132 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-2r-gamma-cd132-protein-mouse-239a-a-hek293-his.html

Purity

95.0

Smiles

SKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEA

Molecular Formula

16186 (Gene_ID) Q3UPA9 (S25-A263) (Accession)

Molecular Weight

50-75 kDa

References & Citations

[1]X Cao, et al. Characterization of cDNAs encoding the murine interleukin 2 receptor (IL-2R) gamma chain: chromosomal mapping and tissue specificity of IL-2R gamma chain expression. Proc Natl Acad Sci U S A. 1993 Sep 15;90 (18) :8464-8.|[2]S Hodge, et al. Surface and intracellular interleukin-2 receptor expression on various resting and activated populations involved in cell-mediated immunity in human peripheral blood. Scand J Immunol. 2000 Jan;51 (1) :67-72.|[3]W P Weidanz, et al. Signalling through the IL-2 receptor γ (c) peptide (CD132) is essential for the expression of immunity to Plasmodium chabaudi adami blood-stage malaria.|[4]J P DiSanto, et al. Lymphoid development in mice with a targeted deletion of the interleukin 2 receptor gamma chain. Proc Natl Acad Sci U S A. 1995 Jan 17;92 (2) :377-81.|[5]Leonard D Shultz, et al. Humanized NOD/LtSz-scid IL2 receptor common gamma chain knockout mice in diabetes research. Ann N Y Acad Sci. 2007 Apr;1103:77-89.|[6]Mengmeng Zhao, et al. Expression of Interleukin-2 receptor subunit gamma (IL-2Rγ) and its binding with IL-2 induced activation of CD4 T lymphocytes in flounder (Paralichthys olivaceus) . Fish Shellfish Immunol. 2022 Mar;122:426-436.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MICB CHO-K1 Cell Line
ABC-X0451F 1 Vial

MICB CHO-K1 Cell Line

Sign In for Pricing
View Details
1,2-Dichlorobenzene, GlenDry™, anhydrous
GS4126-1l 1 L

1,2-Dichlorobenzene, GlenDry™, anhydrous

Sign In for Pricing
View Details
Label Cartridge B499 22.86 x 12.7mm White Nylon
LAB4552 1 Each

Label Cartridge B499 22.86 x 12.7mm White Nylon

Sign In for Pricing
View Details
ANXA3, ID (Annexin A3, Annexin-3, Annexin III, Lipocortin III, Placental Anticoagulant Protein III, PAP-III, 35-alpha Calcimedin, Inositol 1,2-cyclic Phosphate 2-phosphohydrolase, ANX3) (MaxLight 550) discontinued
A2295-28C-ML550 100 µL

ANXA3, ID (Annexin A3, Annexin-3, Annexin III, Lipocortin III, Placental Anticoagulant Protein III, PAP-III, 35-alpha Calcimedin, Inositol 1,2-cyclic Phosphate 2-phosphohydrolase, ANX3) (MaxLight 550) discontinued

Sign In for Pricing
View Details
MRPS11 (NM_176805) Human Over-expression Lysate
LY406128 100 µg

MRPS11 (NM_176805) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Peroxisome Proliferator-activated receptor gamma, PPAR-gamma ELISA Kit
MBS164890-01 48 Well

Human Peroxisome Proliferator-activated receptor gamma, PPAR-gamma ELISA Kit

Sign In for Pricing
View Details