Question 1

What is the catalog number for Exendin-4 peptide derivative?

Accepted Answer

The catalog number for Exendin-4 peptide derivative is M29860.

Question 2

What sizes are available for Exendin-4 peptide derivative?

Accepted Answer

Exendin-4 peptide derivative is available in the following size(s): 100 mg, 200 mg, 500 mg, Inquire.

Question 3

How many pack sizes does Exendin-4 peptide derivative come in?

Accepted Answer

Exendin-4 peptide derivative is available in 4 different pack sizes.

Question 4

Is Exendin-4 peptide derivative in stock?

Accepted Answer

Exendin-4 peptide derivative is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

What is Exendin-4 peptide derivative used for?

Accepted Answer

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

Question 6

How do I reconstitute this lyophilized product?

Accepted Answer

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

Question 7

What is the recommended incubation time for this antibody?

Accepted Answer

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

Question 8

What should I check when this product first arrives?

Accepted Answer

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Exendin-4 peptide derivative

Product Specifications

Stability

Purity

Weight

Molecular Formula

Notes

Receptor

Available Sizes

Frequently Asked Questions

Explore Other Products

COG3 Human Gene Knockout Kit (CRISPR)

Cefpiramide

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Tissue FFPE Sections, Small intestine

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3079), CF640R conjugate, 0.1mg/mL

Human BCAM Antibody Pair Set