EDNRA, Human (P.pastoris, His)
EDNRA Protein, a receptor for endothelin-1, activates a phosphatidylinositol-calcium second messenger system through association with G proteins. Its binding affinities follow the order: ET1 > ET2 >> ET3. Additionally, EDNRA interacts with HDAC7 and KAT5. EDNRA Protein, Human (P.pastoris, His) is the recombinant human-derived EDNRA protein, expressed by P. pastoris , with N-His labeled tag.
Product Specifications
Product Name Alternative
EDNRA Protein, Human (P.pastoris, His), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ednra-protein-human-p-pastoris-his.html
Purity
98.00
Smiles
DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK
Molecular Formula
1909 (Gene_ID) P25101 (D21-K80) (Accession)
Molecular Weight
Approximately 62 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Lentiviral mouse Tcp11 shRNA (UAS) - Lentiviral mouse Tcp11 shRNA (UAS, RFP) (100)
NKX1-1, ID (NKX1-1, HPX153, NK1 transcription factor-related protein 1, Homeobox protein 153, Homeobox protein SAX-2, NKX-1.1) (FITC)
NKX1-1, ID (NKX1-1, HPX153, NK1 transcription factor-related protein 1, Homeobox protein 153, Homeobox protein SAX-2, NKX-1.1) (FITC)
