Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Notch homolog 2 N-terminal-like protein B (NOTCH2NLB)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human NOTCH2NLB protein

Gene Name

NOTCH2NLB

UniProt

P0DPK3

Expression Region

26-275aa

Organism

Homo sapiens (Human)

Target Sequence

LQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

Human-specific protein that promotes neural progenitor proliferation and evolutionary expansion of the brain neocortex by regulating the Notch signaling pathway (PubMed:29856954, PubMed:29856955, PubMed:29561261) . Able to promote neural progenitor self-renewal, possibly by down-regulating neuronal differentiation genes, thereby delaying the differentiation of neuronal progenitors and leading to an overall final increase in neuronal production (PubMed:29856954, PubMed:29856955) . Acts by enhancing the Notch signaling pathway via two different mechanisms that probably work in parallel to reach the same effect (PubMed:29856954, PubMed:29856955) . Enhances Notch signaling pathway in a non-cell-autonomous manner via direct interaction with NOTCH2 (PubMed:29856954) . Also promotes Notch signaling pathway in a cell-autonomous manner through inhibition of cis DLL1-NOTCH2 interactions, which promotes neuronal differentiation (PubMed:29856955) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.3 kDa

References & Citations

"Human-specific NOTCH2NL genes affect Notch signaling and cortical neurogenesis." Fiddes I.T., Lodewijk G.A., Mooring M., Bosworth C.M., Ewing A.D., Mantalas G.L., Novak A.M., van den Bout A., Bishara A., Rosenkrantz J.L., Lorig-Roach R., Field A.R., Haeussler M., Russo L., Bhaduri A., Nowakowski T.J., Pollen A.A., Dougherty M.L. Haussler D. Cell 173:1356-1369 (2018)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit
MBS9359322-01 48 Well

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit
MBS9359322-02 96 Well

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit
MBS9359322-03 5x 96 Well

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit
MBS9359322-04 10x 96 Well

Mouse Niemann Pick C1 Protein (NPC1) ELISA Kit

Sign In for Pricing
View Details
DMAC2 Rabbit Polyclonal Antibody
TA330665 100 µL

DMAC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SATB1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2090606 1.0 µg DNA

SATB1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details