Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-23, Rat (HEK293, His)

IL-23 alpha protein has cytokine activity and binds to the interleukin 23 receptor. It regulates cytokine production, lymphocyte activation, and peptidyl tyrosine phosphorylation. IL-23 Protein, Rat (HEK293, His) is a recombinant protein dimer complex containing rat-derived IL-23 alpha & IL-12 beta Heterodimer protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-23 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-23-protein-rat-hek293-his.html

Purity

95.00

Smiles

IL-23alpha:VPRSSSPDWAQCQQLSRNLCTLAWSAHTPVGQMDLLREEGEEETKSDVPRIQCGDGCDPQGLKDNSQFCLQRIRQGLVFYKHLLDSDIFTGEPSLLPDSPVDQLHTSLLGLSQLLQPEDHHWETQQMPRLSPSQQWQRSLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTAIL-12beta:MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGAASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS

Molecular Formula

155140&64546 (Gene_ID) NP_569094.1 (V22-A196) & EDM04146.1 (M23-S335) (Accession)

Molecular Weight

Approximately 22-23 kDa (IL-23A) & 42-50 kDa ((IL-12B) )

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AZD 2066 hydrate
T61708-01 25 mg

AZD 2066 hydrate

Sign In for Pricing
View Details
AZD 2066 hydrate
T61708-02 50 mg

AZD 2066 hydrate

Sign In for Pricing
View Details
Attractin Polyclonal Antibody, Cy5.5 Conjugated
bs-12551R-Cy5.5 100 µL

Attractin Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Tars2 (NM_027931) Mouse Tagged Lenti ORF Clone
MR217485L3 10 µg

Tars2 (NM_027931) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phospho-GluR1 (Ser831) Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62187R-BF555 100 µL

Phospho-GluR1 (Ser831) Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Human KRTAP4-2 Pre-designed siRNA Set B
SI008467B 1 Each

Human KRTAP4-2 Pre-designed siRNA Set B

Sign In for Pricing
View Details