Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Mouse

The FGF-4 protein plays a key role in embryonic development and is central to cell proliferation and differentiation. It is essential for the survival of mouse embryos after implantation and is key to normal limb and heart valve development. FGF-4 Protein, Mouse is the recombinant mouse-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-mouse.html

Purity

99.90

Smiles

SGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL

Molecular Formula

14175 (Gene_ID) P11403 (S67-L202) (Accession)

Molecular Weight

Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SCYL1BP1 (GORAB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]
TA505077AM 100 µL

SCYL1BP1 (GORAB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]

Ask
View Details
TMEM30A AAV Vector (Human) (CMV)
47037101 1 µg

TMEM30A AAV Vector (Human) (CMV)

Ask
View Details
OAT1 (Solute Carrier Family 22 Member 6, Organic Anion Transporter 1, hOAT1, PAH Transporter, hPAHT, Renal Organic Anion Transporter 1, hROAT1, SLC22A6, OAT1, PAHT)
224673-01 50 µL

OAT1 (Solute Carrier Family 22 Member 6, Organic Anion Transporter 1, hOAT1, PAH Transporter, hPAHT, Renal Organic Anion Transporter 1, hROAT1, SLC22A6, OAT1, PAHT)

Ask
View Details
OAT1 (Solute Carrier Family 22 Member 6, Organic Anion Transporter 1, hOAT1, PAH Transporter, hPAHT, Renal Organic Anion Transporter 1, hROAT1, SLC22A6, OAT1, PAHT)
224673-02 100 µL

OAT1 (Solute Carrier Family 22 Member 6, Organic Anion Transporter 1, hOAT1, PAH Transporter, hPAHT, Renal Organic Anion Transporter 1, hROAT1, SLC22A6, OAT1, PAHT)

Ask
View Details