Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Mouse

The FGF-4 protein plays a key role in embryonic development and is central to cell proliferation and differentiation. It is essential for the survival of mouse embryos after implantation and is key to normal limb and heart valve development. FGF-4 Protein, Mouse is the recombinant mouse-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-mouse.html

Purity

99.90

Smiles

SGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL

Molecular Formula

14175 (Gene_ID) P11403 (S67-L202) (Accession)

Molecular Weight

Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H3C15 Human Over-expression Lysate
orb1358752 100 µg

H3C15 Human Over-expression Lysate

Sign In for Pricing
View Details
LPAR5 (Lysophosphatidic Acid Receptor 5, LPA Receptor 5, LPA-5, G-protein Coupled Receptor 92, G-protein Coupled Receptor 93, GPR92, GPR93) (MaxLight 405) discontinued
217517-ML405 100 µL

LPAR5 (Lysophosphatidic Acid Receptor 5, LPA Receptor 5, LPA-5, G-protein Coupled Receptor 92, G-protein Coupled Receptor 93, GPR92, GPR93) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Wwtr1 3'UTR GFP Stable Cell Line
TU172356 1.0 mL

Wwtr1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
2-Chloro-4-formylthiazole
416769-01 100 mg

2-Chloro-4-formylthiazole

Sign In for Pricing
View Details
2-Chloro-4-formylthiazole
416769-02 250 mg

2-Chloro-4-formylthiazole

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Sulfate adenylyltransferase subunit 2 (cysD)
MBS1154442-01 0.02 mg (E-Coli)

Recombinant Acinetobacter baumannii Sulfate adenylyltransferase subunit 2 (cysD)

Sign In for Pricing
View Details