Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Mouse

The FGF-4 protein plays a key role in embryonic development and is central to cell proliferation and differentiation. It is essential for the survival of mouse embryos after implantation and is key to normal limb and heart valve development. FGF-4 Protein, Mouse is the recombinant mouse-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-mouse.html

Purity

99.90

Smiles

SGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL

Molecular Formula

14175 (Gene_ID) P11403 (S67-L202) (Accession)

Molecular Weight

Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCDC25/Coiled-coil domain-containing protein 25 ELISA Kit
MBS2903697-01 48 Well

Human CCDC25/Coiled-coil domain-containing protein 25 ELISA Kit

Sign In for Pricing
View Details
Human CCDC25/Coiled-coil domain-containing protein 25 ELISA Kit
MBS2903697-02 96 Well

Human CCDC25/Coiled-coil domain-containing protein 25 ELISA Kit

Sign In for Pricing
View Details
Human CCDC25/Coiled-coil domain-containing protein 25 ELISA Kit
MBS2903697-03 5x 96 Well

Human CCDC25/Coiled-coil domain-containing protein 25 ELISA Kit

Sign In for Pricing
View Details
Human CCDC25/Coiled-coil domain-containing protein 25 ELISA Kit
MBS2903697-04 10x 96 Well

Human CCDC25/Coiled-coil domain-containing protein 25 ELISA Kit

Sign In for Pricing
View Details
Doxycycline HCl
C17371-10mM/1mL 10 mM/1mL

Doxycycline HCl

Sign In for Pricing
View Details
MKNK1 (MAP Kinase Interacting Serine/Threonine Kinase 1, MNK1) (MaxLight 750) discontinued
248780-ML750 100 µL

MKNK1 (MAP Kinase Interacting Serine/Threonine Kinase 1, MNK1) (MaxLight 750) discontinued

Sign In for Pricing
View Details