Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Mouse

The FGF-4 protein plays a key role in embryonic development and is central to cell proliferation and differentiation. It is essential for the survival of mouse embryos after implantation and is key to normal limb and heart valve development. FGF-4 Protein, Mouse is the recombinant mouse-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-mouse.html

Purity

99.90

Smiles

SGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL

Molecular Formula

14175 (Gene_ID) P11403 (S67-L202) (Accession)

Molecular Weight

Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Herpes Simplex  Virus (HSV) Type1 &2
1107NF-304M 5ml

Goat Anti-Herpes Simplex Virus (HSV) Type1 &2

Sign In for Pricing
View Details
DNA Repair Protein Complementing XP-G Cells (ERCC5) Antibody
abx001349-01 20 µL

DNA Repair Protein Complementing XP-G Cells (ERCC5) Antibody

Sign In for Pricing
View Details
DNA Repair Protein Complementing XP-G Cells (ERCC5) Antibody
abx001349-02 100 µL

DNA Repair Protein Complementing XP-G Cells (ERCC5) Antibody

Sign In for Pricing
View Details
DNA Repair Protein Complementing XP-G Cells (ERCC5) Antibody
abx001349-03 2x 100 µL

DNA Repair Protein Complementing XP-G Cells (ERCC5) Antibody

Sign In for Pricing
View Details
PLenti-SFFV-MCS-EF1-Puro Lentiviral Expression Vector
LV451 10 µg

PLenti-SFFV-MCS-EF1-Puro Lentiviral Expression Vector

Sign In for Pricing
View Details
Spnb4 Protein Vector (Mouse) (pPB-C-His)
PV233510 500 ng

Spnb4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details