FGF-4, Mouse
The FGF-4 protein plays a key role in embryonic development and is central to cell proliferation and differentiation. It is essential for the survival of mouse embryos after implantation and is key to normal limb and heart valve development. FGF-4 Protein, Mouse is the recombinant mouse-derived FGF-4 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
FGF-4 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-4-protein-mouse.html
Purity
99.90
Smiles
SGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL
Molecular Formula
14175 (Gene_ID) P11403 (S67-L202) (Accession)
Molecular Weight
Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Mouse Troponin T, cardiac muscle,TNNT2 ELISA KIT
Mouse Troponin T, cardiac muscle,TNNT2 ELISA KIT
CD82 (C33 Antigen, IA4, Inducible Membrane Protein R2, KAI 1, KAI1, Kangai 1, Kangai1, Metastasis Suppressor Kangai 1, R2 leukocyte antigen, SAR2, ST6, Suppression of Tumorigenicity 6 Protein, Tetraspanin 27, Tspan-27, SAR2, ST6, TSPAN27)
Rabbit anti-Caenorhabditis elegans B0563.5 Polyclonal Antibody
