Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Mouse

The FGF-4 protein plays a key role in embryonic development and is central to cell proliferation and differentiation. It is essential for the survival of mouse embryos after implantation and is key to normal limb and heart valve development. FGF-4 Protein, Mouse is the recombinant mouse-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-mouse.html

Purity

99.90

Smiles

SGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL

Molecular Formula

14175 (Gene_ID) P11403 (S67-L202) (Accession)

Molecular Weight

Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DOCK7 activation kit by CRISPRa
GA113882 1 Kit

Human DOCK7 activation kit by CRISPRa

Sign In for Pricing
View Details
Box of 100 Very Fast Qualitative Filter, 148 Mm
QL01A0148C Box of 100

Box of 100 Very Fast Qualitative Filter, 148 Mm

Sign In for Pricing
View Details
Rabbit anti-human glutamic-pyruvate transaminase (alanine aminotransferase) polyclonal Antibody
MBS713688-01 0.1 mL

Rabbit anti-human glutamic-pyruvate transaminase (alanine aminotransferase) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human glutamic-pyruvate transaminase (alanine aminotransferase) polyclonal Antibody
MBS713688-02 5x 0.1 mL

Rabbit anti-human glutamic-pyruvate transaminase (alanine aminotransferase) polyclonal Antibody

Sign In for Pricing
View Details
TNFSF12 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
47223061 1.0 µg DNA

TNFSF12 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Stanniocalcin 1 (STC1) (NM_003155) Human Tagged ORF Clone Lentiviral Particle
RC206573L1V 200 µL

Stanniocalcin 1 (STC1) (NM_003155) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details