Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-2, Mouse (145a.a)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF-2 Protein, Mouse (145a.a), consists of 145 amino acids, produced by E.coli with tag free.

Product Specifications

Product Name Alternative

FGF-2 Protein, Mouse (145a.a), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-2-protein-mouse-145a-a.html

Purity

97.00

Smiles

PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

14173 (Gene_ID) P15655 (P10-S154) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Westermann R, et al. Basic fibroblast growth factor (bFGF), a multifunctional growth factor for neuroectodermal cells. J Cell Sci Suppl. 1990;13:97-117.|[2]Rusnati M, et al. Interaction of angiogenic basic fibroblast growth factor with endothelial cell heparan sulfate proteoglycans. Biological implications in neovascularization. Int J Clin Lab Res. 1996;26 (1) :15-23.|[3]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[4]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PSTK Rabbit Polyclonal Antibody
TA337846 100 µL

PSTK Rabbit Polyclonal Antibody

Ask
View Details
Human Macrophage Scavenger Receptor 1 (MSR1) ELISA Kit
MBS450179-01 48 Tests

Human Macrophage Scavenger Receptor 1 (MSR1) ELISA Kit

Ask
View Details
Human Macrophage Scavenger Receptor 1 (MSR1) ELISA Kit
MBS450179-02 96 Tests

Human Macrophage Scavenger Receptor 1 (MSR1) ELISA Kit

Ask
View Details
Human Macrophage Scavenger Receptor 1 (MSR1) ELISA Kit
MBS450179-03 5x 96 Tests

Human Macrophage Scavenger Receptor 1 (MSR1) ELISA Kit

Ask
View Details
Human Macrophage Scavenger Receptor 1 (MSR1) ELISA Kit
MBS450179-04 10x 96 Tests

Human Macrophage Scavenger Receptor 1 (MSR1) ELISA Kit

Ask
View Details
Human SEPP1(Selenoprotein P, Plasma)ELISA Kit
MBS2515309-01 24 Tests (Limit 1)

Human SEPP1(Selenoprotein P, Plasma)ELISA Kit

Ask
View Details