Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pinctada fucata Mantle gene 8

Product Specifications

Abbreviation

Recombinant Pinctada fucata Mantle gene 8 protein

UniProt

Q3YL58

Expression Region

22-223aa

Organism

Pinctada fucata (Akoya pearl oyster) (Pinctada imbricata fucata)

Target Sequence

WLFGSSSSSSSWGSRYSSPSSFSTRWSRYSPSWSSSRYTPSWSSSRYTPSWSSSRYSPSWSSSRSRFSSSRSSFPHDIKSKSGLNSLYNSRVTKVETFERPIRGMGGIKHNGVVATTKDGGRWLIHKGIGYGKSSDTVVTNARHMSSQWKPAGAKSARPGTTIGGLVKAGLANKRWNPWDAKCWDATDGMMKKAGRRKRATC

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pard6a (NM_001003653) Rat Tagged Lenti ORF Clone
RR200100L4 10 µg

Pard6a (NM_001003653) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Anti-EBFP antibody
SLM-33185M-01 100 µL

Mouse Anti-EBFP antibody

Sign In for Pricing
View Details
Mouse Anti-EBFP antibody
SLM-33185M-02 500 µL

Mouse Anti-EBFP antibody

Sign In for Pricing
View Details
GSK3368715 dihydrochloride 1mg
A21733-1 1 mg

GSK3368715 dihydrochloride 1mg

Sign In for Pricing
View Details
Goat anti-GFP Polyclonal antibody
AB0020-200 400 µg

Goat anti-GFP Polyclonal antibody

Sign In for Pricing
View Details
Pja2 Rabbit Polyclonal Antibody
TA356326 100 µL

Pja2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details