Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pinctada fucata Mantle gene 8

Product Specifications

Abbreviation

Recombinant Pinctada fucata Mantle gene 8 protein

UniProt

Q3YL58

Expression Region

22-223aa

Organism

Pinctada fucata (Akoya pearl oyster) (Pinctada imbricata fucata)

Target Sequence

WLFGSSSSSSSWGSRYSSPSSFSTRWSRYSPSWSSSRYTPSWSSSRYTPSWSSSRYSPSWSSSRSRFSSSRSSFPHDIKSKSGLNSLYNSRVTKVETFERPIRGMGGIKHNGVVATTKDGGRWLIHKGIGYGKSSDTVVTNARHMSSQWKPAGAKSARPGTTIGGLVKAGLANKRWNPWDAKCWDATDGMMKKAGRRKRATC

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10T2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1555007 1.0 µg DNA

OR10T2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CD31 Monoclonal Antibody
RA10928-01 50 µL

CD31 Monoclonal Antibody

Sign In for Pricing
View Details
CD31 Monoclonal Antibody
RA10928-02 100 µL

CD31 Monoclonal Antibody

Sign In for Pricing
View Details
Olr396 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7155506 1.0 µg DNA

Olr396 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human RNF167 shRNA Plasmid
abx958644-01 150 µg

Human RNF167 shRNA Plasmid

Sign In for Pricing
View Details
Human RNF167 shRNA Plasmid
abx958644-02 300 µg

Human RNF167 shRNA Plasmid

Sign In for Pricing
View Details