Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-6, Human (N-His)

IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. IL-6 Protein, Human (N-His) is the recombinant human-derived IL-6 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-6 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-6-protein-human-n-his.html

Purity

95.0

Smiles

PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Molecular Formula

3569 (Gene_ID) P05231 (P29-M212) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR9A1P siRNA Oligos set (Human)
35697171 3x 5 nmol

OR9A1P siRNA Oligos set (Human)

Sign In for Pricing
View Details
HAVCR1 Antibody
E031156 100 µg -100 µL

HAVCR1 Antibody

Sign In for Pricing
View Details
Human anti-P. aeruginosa Psl IgM
E4A11A48-PS-M 50 µg

Human anti-P. aeruginosa Psl IgM

Sign In for Pricing
View Details
Goose B Lymphocyte Stimulator (BLYS) ELISA Kit
MBS9345188 Inquire

Goose B Lymphocyte Stimulator (BLYS) ELISA Kit

Sign In for Pricing
View Details
Tbc1d4 (NM_001081278) Mouse Tagged Lenti ORF Clone
MR219269L3 10 µg

Tbc1d4 (NM_001081278) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat CTX-II (Cross Linked C-telopeptide of Type II Collagen) Quick ELISA Kit
orb2567621-01 48 Tests

Rat CTX-II (Cross Linked C-telopeptide of Type II Collagen) Quick ELISA Kit

Sign In for Pricing
View Details