Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL5 (RANTES) Recombinant Protein

The Bovine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS) . For research use only.

Product Specifications

Background

CCL5, also know as RANTES (regulated and normal T cell expressed and secreted) is a member of the C-C Chemokine subfamily. There are at least 27 distinct members of the C-C subgroup reported for mammals. CCL5 is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. CCL5 plays a role in many disease states, including rheumatoid arthritis, HIV, and cancer.

Sequence

SPYASDTTPC CFAYISRPLP RTHVQEYFYT SSKCSMAAVV FITRKNRQVC ANPEKKWVRE YINALELS (68)

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Bos taurus (cattle), Bubalus bubalis (water buffalo), Bubalus kerabau (carabao)

Endotoxin

Naturally endotoxin-free

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

7.9 kDa

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM20 Protein Vector (Mouse) (pPM-C-His)
PV222853 500 ng

RBM20 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) TTD14 Polyclonal Antibody
MBS7145310 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) TTD14 Polyclonal Antibody

Sign In for Pricing
View Details
HBE1 Antibody
OACA03096-50UG 50 µg

HBE1 Antibody

Sign In for Pricing
View Details
FOS Antibody (Phospho-Thr232)
OAAN02734-200UL 200 µL

FOS Antibody (Phospho-Thr232)

Sign In for Pricing
View Details
Lentiviral mouse Blvra shRNA (UAS) - Lentiviral mouse Blvra shRNA (UAS, RFP) (100)
GTR15145380 1 Vial

Lentiviral mouse Blvra shRNA (UAS) - Lentiviral mouse Blvra shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
GAS2L1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV710333 1.0 µg DNA

GAS2L1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details