Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL5 (RANTES) Recombinant Protein

The Bovine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS) . For research use only.

Product Specifications

Background

CCL5, also know as RANTES (regulated and normal T cell expressed and secreted) is a member of the C-C Chemokine subfamily. There are at least 27 distinct members of the C-C subgroup reported for mammals. CCL5 is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. CCL5 plays a role in many disease states, including rheumatoid arthritis, HIV, and cancer.

Sequence

SPYASDTTPC CFAYISRPLP RTHVQEYFYT SSKCSMAAVV FITRKNRQVC ANPEKKWVRE YINALELS (68)

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Bos taurus (cattle), Bubalus bubalis (water buffalo), Bubalus kerabau (carabao)

Endotoxin

Naturally endotoxin-free

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

7.9 kDa

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pesticide Std HCH-alpha Neat - 10MG
REPET140N 10 mg

Pesticide Std HCH-alpha Neat - 10MG

Sign In for Pricing
View Details
PLK4 Mouse Monoclonal Antibody [Clone ID: LBI3G10]
AMM19662VCF 100 µg

PLK4 Mouse Monoclonal Antibody [Clone ID: LBI3G10]

Sign In for Pricing
View Details
Anti-POU5F2 Polyclonal Antibody
TMAB-11638-01 50 μL

Anti-POU5F2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-POU5F2 Polyclonal Antibody
TMAB-11638-02 100 µL

Anti-POU5F2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-POU5F2 Polyclonal Antibody
TMAB-11638-03 200 µL

Anti-POU5F2 Polyclonal Antibody

Sign In for Pricing
View Details
Human OSGIN2 Knockout HEK293T cell line
GTR15402865 1 Vial

Human OSGIN2 Knockout HEK293T cell line

Sign In for Pricing
View Details