Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guinea Pig TGF-alpha Recombinant Protein

The Guinea Pig TGF-alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig TGF-alpha applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig TGF-alpha yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig TGF-alpha Specifications: (Molecular Weight: 5.6 kDa) (Amino Acid Sequence: VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLL) (Gene ID: 102005158) . For research use only.

Product Specifications

Background

Transforming growth factor alpha (TGF-α) is a member of the epidermal growth factor (EGF) family. TGF-α can be produced in macrophages, brain cells, and keratinocytes. TGF-α has also been observed to be highly expressed in the suprachiasmatic nucleus (SCN) (5) . This finding suggests a role for EGFR signaling in the regulation of CLOCK and circadian rhythms within the SCN. Additional studies have shown that when injected into the third ventricle TGF-α can suppress circadian locomotor behavior along with drinking or eating activities.

Sequence

VLSHFNDCPD SHTQFCFHGT CRFLVQEDKP ACVCHSGYVG ARCEHADLLA (50)

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Cavia porcellus (Domestic guinea pig), Chinchilla lanigera (long-tailed chinchilla)

Endotoxin

Naturally endotoxin-free

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

5.6 kDa

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSGA13, CT (TSGA13, Testis-specific gene 13 protein) (MaxLight 405) discontinued
043361-ML405 100 µL

TSGA13, CT (TSGA13, Testis-specific gene 13 protein) (MaxLight 405) discontinued

Sign In for Pricing
View Details
GcvP Antibody
orb815954 2 mg

GcvP Antibody

Sign In for Pricing
View Details
PILR-α Lentiviral Activation Particles (m)
sc-433105-LAC 200 µL

PILR-α Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
PDLIM1, CT (PDLIM1, CLIM1, CLP36, PDZ and LIM domain protein 1, C-terminal LIM domain protein 1, Elfin, LIM domain protein CLP-36) (PE) discontinued
039850-PE 200 µL

PDLIM1, CT (PDLIM1, CLIM1, CLP36, PDZ and LIM domain protein 1, C-terminal LIM domain protein 1, Elfin, LIM domain protein CLP-36) (PE) discontinued

Sign In for Pricing
View Details
Bisphenol B Mono-b-D-glucuronide
TRC-B519463-10MG 10 mg

Bisphenol B Mono-b-D-glucuronide

Sign In for Pricing
View Details
Hexylsilane
sc-224016 5 mL

Hexylsilane

Sign In for Pricing
View Details