Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Feline SCF (Stem Cell Factor) Recombinant Protein

The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 27.9 kDa) (Amino Acid Sequence: GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 493937) . For research use only.

Product Specifications

Background

SCF (stem cell factor), often known as Kit Ligand, KITL or KITLG, is involved in pathways that control the regulation of cell survival, migration and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, and melanogenesis. The SCF of most vertebrates has a soluble form as well as the membrane bound type I receptor form. Mutations in the SCF pathway may result in a broad range of abnormalities including anemia, and sterility. SCF and KIT interaction has been shown to promote the growth of cancer cells and organoids in culture, and xenograft tumors in mice. SCF is being utilized in many animal model systems, from metastasis research in breast tumor-bearing arthritic mice to the genetic linkage to de-pigmentation in pigs. Interestingly, a second SCF pathway was retained in zebrafish, after a whole genome duplication, and is now undergoing divergent evolution.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Acinonyx jubatus (cheetah), Felis catus (domestic cat), Leopardus geoffroyi (Geoffroy's cat), Lynx rufus (bobcat), Neofelis nebulosa (Clouded leopard), Panthera leo (lion), Panthera onca (jaguar), Panthera pardus (leopard), Panthera tigris (tiger), Panthera tigris altaica (Amur tiger), Prionailurus bengalensis (leopard cat), Prionailurus viverrinus (fishing cat)

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mucin-5B (MUC5B) Peptide
abx616486 100 µg

Mucin-5B (MUC5B) Peptide

Ask
View Details
Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (MaxLight 550)
MBS6212788-01 0.1 mL

Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (MaxLight 550)

Ask
View Details
Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (MaxLight 550)
MBS6212788-02 5x 0.1 mL

Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (MaxLight 550)

Ask
View Details
Mouse Monoclonal TTP Antibody (OTI8B5) [CoraFluor 1]
NBP2-74681CL1 0.1 mL

Mouse Monoclonal TTP Antibody (OTI8B5) [CoraFluor 1]

Ask
View Details