Feline SCF (Stem Cell Factor) Recombinant Protein
The Feline SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Feline SCF yeast-derived recombinant protein can be purchased in multiple sizes. Feline SCF Specifications: (Molecular Weight: 27.9 kDa) (Amino Acid Sequence: GLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 493937) . For research use only.
Product Specifications
Background
Applications
Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
Homology
Storage Temperature
-20°C
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items