Equine CCL3 (MIP-1 alpha) Recombinant Protein

The Equine CCL3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL3 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL3 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL3 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: VPFGADTPTACCFSYVSRQIPRKFINDYYETSSQCSKPAIIFQTKRSRQVCADPSEAWVQEYVTDLELSA) . For research use only.

Product Specifications

Background

CCL3, also known as Macrophage Inflammatory Protein-1 alpha (MIP-1α) belongs to the CC chemokine family. There are at least 27 distinct members of the C-C subgroup reported for mammals. They are characterized by two adjacent cysteines. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL3 is a chemoattractant for several different leukocytes, with varying degrees of potency (monocytes = T-cells>neutrophils>eosinophils) .