Equine CCL3 (MIP-1 alpha) Recombinant Protein
The Equine CCL3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL3 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL3 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL3 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: VPFGADTPTACCFSYVSRQIPRKFINDYYETSSQCSKPAIIFQTKRSRQVCADPSEAWVQEYVTDLELSA) . For research use only.
Product Specifications
Background
CCL3, also known as Macrophage Inflammatory Protein-1 alpha (MIP-1α) belongs to the CC chemokine family. There are at least 27 distinct members of the C-C subgroup reported for mammals. They are characterized by two adjacent cysteines. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL3 is a chemoattractant for several different leukocytes, with varying degrees of potency (monocytes = T-cells>neutrophils>eosinophils) .
Applications
Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
Homology
Equus caballus (horse), Equus przewalskii (Przewalski's horse)
Storage Temperature
-20°C
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS7160646 Inquire
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) DUS1 Polyclonal Antibody
Ask
View Details MBS1212133-01 0.02 mg (E-Coli)
Recombinant Arthrobacter aurescens 10 kDa chaperonin (groS)
Ask
View Details MBS1212133-02 0.1 mg (E-Coli)
Recombinant Arthrobacter aurescens 10 kDa chaperonin (groS)
Ask
View Details MBS1212133-03 0.02 mg (Yeast)
Recombinant Arthrobacter aurescens 10 kDa chaperonin (groS)
Ask
View Details