Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine IL-1 beta Biotinylated Recombinant Protein

The Canine IL-1 beta Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 beta Biotinylated applications are for cell culture. Canine IL-1 beta Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 beta Biotinylated Specifications: (Molecular Weight: 17.5 kDa) (Amino Acid Sequence: AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS) (Gene ID: 403974) . For research use only.

Product Specifications

Background

IL-1 beta is produced by activated macrophages, monocytes, and a subset of dentritic cells. This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α, IL-1β, and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an 'alarmin' released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.

Label

Biotin

Applications

Cell Culture

Homology

Canis lupus dingo (dingo), Canis lupus familiaris (dog)

Purity

>98% as visualized by SDS-PAGE analysis.

Storage Temperature

-20°C

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gas2l1 Rat shRNA Plasmid (Locus ID 360973)
TR706903 1 Kit

Gas2l1 Rat shRNA Plasmid (Locus ID 360973)

Sign In for Pricing
View Details
IFN gamma Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-0481R-BF750-TR 20 µL

IFN gamma Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Canine alanyl (membrane) aminopeptidase (ANPEP) ELISA Kit
MBS7242603-01 48 Well

Canine alanyl (membrane) aminopeptidase (ANPEP) ELISA Kit

Sign In for Pricing
View Details
Canine alanyl (membrane) aminopeptidase (ANPEP) ELISA Kit
MBS7242603-02 96 Well

Canine alanyl (membrane) aminopeptidase (ANPEP) ELISA Kit

Sign In for Pricing
View Details
Canine alanyl (membrane) aminopeptidase (ANPEP) ELISA Kit
MBS7242603-03 5x 96 Well

Canine alanyl (membrane) aminopeptidase (ANPEP) ELISA Kit

Sign In for Pricing
View Details
Canine alanyl (membrane) aminopeptidase (ANPEP) ELISA Kit
MBS7242603-04 10x 96 Well

Canine alanyl (membrane) aminopeptidase (ANPEP) ELISA Kit

Sign In for Pricing
View Details