Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine IL-1 beta Biotinylated Recombinant Protein

The Canine IL-1 beta Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 beta Biotinylated applications are for cell culture. Canine IL-1 beta Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 beta Biotinylated Specifications: (Molecular Weight: 17.5 kDa) (Amino Acid Sequence: AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS) (Gene ID: 403974) . For research use only.

Product Specifications

Background

IL-1 beta is produced by activated macrophages, monocytes, and a subset of dentritic cells. This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α, IL-1β, and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an 'alarmin' released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.

Label

Biotin

Applications

Cell Culture

Homology

Canis lupus dingo (dingo), Canis lupus familiaris (dog)

Purity

>98% as visualized by SDS-PAGE analysis.

Storage Temperature

-20°C

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIF3L1 Rabbit Polyclonal Antibody (HRP)
orb2082128 100 µL

NIF3L1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
L1RE1 Rabbit Polyclonal Antibody (Fluoro594)
orb3094073 100 µg

L1RE1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Anti-FBXO21 Antibody Picoband® Cy3 Conjugated
A13227-1-Cy3 100 µg/Vial

Anti-FBXO21 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Human PD-L1 (19-132) Protein, hFc Tag
orb2321289-01 10 µg

Human PD-L1 (19-132) Protein, hFc Tag

Sign In for Pricing
View Details
Human PD-L1 (19-132) Protein, hFc Tag
orb2321289-02 50 µg

Human PD-L1 (19-132) Protein, hFc Tag

Sign In for Pricing
View Details
Human PD-L1 (19-132) Protein, hFc Tag
orb2321289-03 100 µg

Human PD-L1 (19-132) Protein, hFc Tag

Sign In for Pricing
View Details