Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL-1 beta Recombinant Protein

The Mouse IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-1 beta Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152) ) (Gene ID: 16176) . For research use only.

Product Specifications

Background

IL-1 beta is produced by activated macrophages, monocytes, and a subset of dentritic cells. This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α, IL-1β, and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an 'alarmin' released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Mus musculus (house mouse)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

17.4 kDa

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Vitamin K1 (VK1) ELISA Kit
NSL0045r 96 Tests

Rat Vitamin K1 (VK1) ELISA Kit

Sign In for Pricing
View Details
IL18 R1 Recombinant Protein C-Fc Tag Lyophilized 200UG
IIL18R1RCFCLY200UG 200 µg

IL18 R1 Recombinant Protein C-Fc Tag Lyophilized 200UG

Sign In for Pricing
View Details
Astn1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3341203 1.0 µg DNA

Astn1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
AURKC Polyclonal Antibody
E916977 100 µL

AURKC Polyclonal Antibody

Sign In for Pricing
View Details
CAMKK2 Antibody
DF4793-01 100 µL

CAMKK2 Antibody

Sign In for Pricing
View Details
CAMKK2 Antibody
DF4793-02 200 µL

CAMKK2 Antibody

Sign In for Pricing
View Details