Equine IL-1 beta Recombinant Protein
The Equine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-1 beta Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: AAVHSVNCRLRDIYHKSLVLSGACELQAVHLNGENTNQQVVFCMSFVQGEEETDKIPVALGLKEKNLYLSCGMKDGKPTLQLETVDPNTYPKRKMEKRFVFNKMEIKGNVEFESAMYPNWYISTSQAEKKPVFLGNTRGGRDITDFIMEITSA) . For research use only.
Product Specifications
Background
Applications
Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
Homology
Equus asinus (ass), Equus caballus (horse)
Storage Temperature
-20°C
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items