Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL-1 beta Recombinant Protein

The Equine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-1 beta Specifications: (Molecular Weight: 17.3 kDa) (Amino Acid Sequence: AAVHSVNCRLRDIYHKSLVLSGACELQAVHLNGENTNQQVVFCMSFVQGEEETDKIPVALGLKEKNLYLSCGMKDGKPTLQLETVDPNTYPKRKMEKRFVFNKMEIKGNVEFESAMYPNWYISTSQAEKKPVFLGNTRGGRDITDFIMEITSA) . For research use only.

Product Specifications

Background

IL-1 beta is produced by activated macrophages, monocytes, and a subset of dentritic cells. This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α, IL-1β, and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an 'alarmin' released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Equus asinus (ass), Equus caballus (horse)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

17.3 kDa

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr129 Lentiviral Activation Particles (m2)
sc-434483-LAC-2 200 µL

Olfr129 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Famotidine Impurity 53
RM-F130453-01 10 mg

Famotidine Impurity 53

Sign In for Pricing
View Details
Famotidine Impurity 53
RM-F130453-02 25 mg

Famotidine Impurity 53

Sign In for Pricing
View Details
Famotidine Impurity 53
RM-F130453-03 50 mg

Famotidine Impurity 53

Sign In for Pricing
View Details
Famotidine Impurity 53
RM-F130453-04 100 mg

Famotidine Impurity 53

Sign In for Pricing
View Details
PURA ORF Vector (Human) (pORF)
38207011 1.0 µg DNA

PURA ORF Vector (Human) (pORF)

Sign In for Pricing
View Details