Human IL-13 Recombinant Protein

The Human IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-13 Specifications: (Molecular Weight: 12.3 kDa) (Amino Acid Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112) ) (Gene ID: 3596) . For research use only.

Product Specifications

Background

IL-13 is secreted by many cell types, but especially T helper type 2 (Th2) cells. IL-13 is an important mediator of allergic inflammation and disease. In addition to effects on immune cells, IL-13 is implicated as a central mediator of the physiologic changes induced by allergic inflammation in many tissues. The functions of IL-13 overlap considerably with those of IL-4, especially with regard to changes induced on hematopoietic cells, but these effects are probably less important given the more potent role of IL-4. Thus, although IL-13 can induce immunoglobulin E (IgE) secretion from activated human B cells, deletion of IL-13 from mice does not markedly affect either Th2 cell development or antigen-specific IgE responses induced by potent allergens.