Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine VEGF-A Biotinylated Recombinant Protein

The Bovine VEGF-A Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine VEGF-A Biotinylated applications are for cell culture. Bovine VEGF-A Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine VEGF-A Biotinylated Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR) (Gene ID: 281572) . For research use only.

Product Specifications

Background

VEGF proteins stimulate vasculogenesis and angiogenesis. They are part of the system that restores the oxygen supply to tissues when blood circulation is inadequate. The normal function of VEGF proteins is to create new blood vessels during embryonic development, new blood vessels after injury, muscle following exercise, and new vessels (collateral circulation) to bypass blocked vessels. The VEGF family has six members, including VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and Placental Growth Factor (PGF) . Activity of VEGF-A, as its name implies, has been studied mostly on cells of the vascular endothelium, although it does have effects on a number of other cell types (e.g., stimulation monocyte/macrophage migration, neurons, cancer cells, kidney epithelial cells) . In vitro, VEGF-A has been shown to stimulate endothelial cell mitogenesis and cell migration. VEGF-A is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor (VPF) .

Label

Biotin

Applications

Cell Culture

Homology

Bison bison bison (American buffalo), Bos taurus (cattle), Bubalus bubalis (water buffalo), Bubalus kerabau (carabao)

Purity

>98% as visualized by SDS-PAGE analysis.

Storage Temperature

-20°C

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HLA C Rabbit Monoclonal Antibody
AMRe85658-01 1 Each

HLA C Rabbit Monoclonal Antibody

Ask
View Details
HLA C Rabbit Monoclonal Antibody
AMRe85658-02 50 µL

HLA C Rabbit Monoclonal Antibody

Ask
View Details
HLA C Rabbit Monoclonal Antibody
AMRe85658-03 100 µL

HLA C Rabbit Monoclonal Antibody

Ask
View Details
PCMV-SNED1-3xHA-Neo Plasmid
PVT69145 2 µg

PCMV-SNED1-3xHA-Neo Plasmid

Ask
View Details
Human SFMBT1 siRNA
abx904887-01 15 nmol

Human SFMBT1 siRNA

Ask
View Details
Human SFMBT1 siRNA
abx904887-02 30 nmol

Human SFMBT1 siRNA

Ask
View Details