Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit CTLA-4 Recombinant Protein

The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124) ) (Gene ID: 100009412) . For research use only.

Product Specifications

Background

CTLA-4 (cytotoxic T-lymphocyte-associated protein 4), also known as CD152, is a protein receptor that, functioning as an immune checkpoint, downregulates immune responses. It is a member of the Ig gene superfamily and along with its homologue, CD28, is a B7 binding protein. CTLA4 is constitutively expressed in regulatory T cells but only upregulated in conventional T cells after activation. It acts as an "off" switch when bound to CD80 or CD86 on the surface of antigen-presenting cells. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. Alternatively spliced mRNA generates a soluble form, called sCTLA-4. Whereas low levels of sCTLA-4 are detected in normal human serum, increased/high serum levels are observed in several autoimmune diseases.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Oryctolagus cuniculus (rabbit)

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FGF3 Human shRNA Plasmid Kit (Locus ID 2248)
TL312990 1 Kit

FGF3 Human shRNA Plasmid Kit (Locus ID 2248)

Ask
View Details
MUNC18 / STXBP1 Immunizing Peptide
MBS425992-01 0.1 mg

MUNC18 / STXBP1 Immunizing Peptide

Ask
View Details
MUNC18 / STXBP1 Immunizing Peptide
MBS425992-02 5x 0.1 mg

MUNC18 / STXBP1 Immunizing Peptide

Ask
View Details
Rabbit Polyclonal DOCK10 Antibody [Alexa Fluor 594]
NB100-60669AF594 0.1 mL

Rabbit Polyclonal DOCK10 Antibody [Alexa Fluor 594]

Ask
View Details
NRAS Antibody, HRP conjugated
A30041-50UG 50 µg

NRAS Antibody, HRP conjugated

Ask
View Details
MAD3 (MXD3) (NM_031300) Human Mass Spec Standard
PH300747 10 µg

MAD3 (MXD3) (NM_031300) Human Mass Spec Standard

Ask
View Details