Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine IL-8 Recombinant Protein

The Canine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP) (Gene ID: 403850) . For research use only.

Product Specifications

Background

IL-8, also known as CXCL8, is a CXC family member chemokine produced by macrophages and other cell types such as epithelial cells. There have been 17 different CXC chemokines described in mammals, that are subdivided into two categories, those with a specific amino acid sequence (or motif) of glutamic acid-leucine-arginine (or ELR for short) immediately before the first cysteine of the CXC motif (ELR-positive), and those without an ELR motif (ELR-negative) . ELR-positive CXC chemokines such as IL-8 specifically induce the migration of neutrophils, and interact with chemokine receptors CXCR1 and CXCR2. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also stimulates phagocytosis once they have arrived. IL-8 is also known to be a potent promoter of angiogenesis. In target cells, IL-8 induces a series of physiological responses required for migration and phagocytosis, such as increases in intracellular Ca2+, exocytosis (e.g. histamine release), and the respiratory burst.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Canis lupus dingo (dingo), Canis lupus familiaris (dog), Nyctereutes procyonoides (raccoon dog), Vulpes lagopus (Arctic fox), Vulpes vulpes (red fox)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

8.6kDa

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Azi2 (NM_001048146) Mouse Tagged Lenti ORF Clone
MR216061L3 10 µg

Azi2 (NM_001048146) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Histone-H2A- (107-122) -Ac-OH
orb1679126-01 1 mg

Histone-H2A- (107-122) -Ac-OH

Sign In for Pricing
View Details
Histone-H2A- (107-122) -Ac-OH
orb1679126-02 5 mg

Histone-H2A- (107-122) -Ac-OH

Sign In for Pricing
View Details
Histone-H2A- (107-122) -Ac-OH
orb1679126-03 10 mg

Histone-H2A- (107-122) -Ac-OH

Sign In for Pricing
View Details
Histone-H2A- (107-122) -Ac-OH
orb1679126-04 25 mg

Histone-H2A- (107-122) -Ac-OH

Sign In for Pricing
View Details
MEF-2 Polyclonal Conjugated Antibody
C41129 100 µL

MEF-2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details