Ferret IFN beta Recombinant Protein
The Ferret IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN beta Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: AMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFKIPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLEEILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKLTDSLPN (166) ) (Gene ID: 101679100) . For research use only.
Product Specifications
Background
Applications
Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
Homology
Mustela putorius furo (domestic ferret)
Purity
>98% as visualized by SDS-PAGE analysis.
Molecular Weight
19.8 kDa
Storage Temperature
-20°C
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Mouse Monoclonal Profilin 1 Antibody (OTI1D5) [Biotin]
