Equine CCL11 (Eotaxin-1) Recombinant Protein
The Equine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL11 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF) . For research use only.
Product Specifications
Background
Applications
Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
Homology
Equus asinus (ass), Equus caballus (horse), Equus przewalskii (Przewalski's horse), Equus quagga (plains zebra)
Purity
>98% as visualized by SDS-PAGE analysis.
Molecular Weight
9.0 kDa
Storage Temperature
-20°C
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog