Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine CCL11 (Eotaxin-1) Recombinant Protein

The Equine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL11 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF) . For research use only.

Product Specifications

Background

CCL11 belongs to the CC chemokine family and is commonly known as Eotaxin-1. There are at least 27 distinct members of the C-C subgroup reported for mammals. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL11 selectively recruits eosinophils by inducing their chemotaxis, and therefore, is implicated in allergic responses. Endothelial cells, smooth muscle cells, epithelial cells, alveolar macrophages and eosinophils are known to produce CCL11.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Equus asinus (ass), Equus caballus (horse), Equus przewalskii (Przewalski's horse), Equus quagga (plains zebra)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

9.0 kDa

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nefopam Hydrochloride
TRC-N389400-10MG 10 mg

Nefopam Hydrochloride

Sign In for Pricing
View Details
CHD5 - S100A 10 FISH Probe
FON-166 10 Tests

CHD5 - S100A 10 FISH Probe

Sign In for Pricing
View Details
FKTN Antibody (HRP)
orb686049-01 50 μL

FKTN Antibody (HRP)

Sign In for Pricing
View Details
FKTN Antibody (HRP)
orb686049-02 100 µL

FKTN Antibody (HRP)

Sign In for Pricing
View Details
Brca2 Mouse shRNA Plasmid (Locus ID 12190)
TR500223 1 Kit

Brca2 Mouse shRNA Plasmid (Locus ID 12190)

Sign In for Pricing
View Details
Olfr378 Mouse shRNA Lentiviral Particle (Locus ID 259026)
TL514333V 500 µL Each

Olfr378 Mouse shRNA Lentiviral Particle (Locus ID 259026)

Sign In for Pricing
View Details