Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Swine TNF alpha Recombinant Protein

The Swine TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Swine TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086) . For research use only.

Product Specifications

Background

TNF alpha is a member of the TNF Superfamily. It is produced chiefly by activated macrophages, but it is produced also by a broad variety of cell types including lymphoid cells, mast cells, endothelial cells, cardiac myocytes, adipose tissue, fibroblasts, and neuronal tissue. The primary role of TNF alpha is in the regulation of immune cells. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Sus scrofa (pig)

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CT47A5 (NM_001080142) Human Over-expression Lysate
LS728072 100 µg

CT47A5 (NM_001080142) Human Over-expression Lysate

Ask
View Details
Znhit6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
51931114 3 x 1.0 µg

Znhit6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Ask
View Details
h.TGFb1
EK0513 1×96T

h.TGFb1

Ask
View Details
FITC-Linked Monoclonal Antibody to Myxovirus Resistance 1 (MX1)
MBS2143236-01 0.1 mL

FITC-Linked Monoclonal Antibody to Myxovirus Resistance 1 (MX1)

Ask
View Details
FITC-Linked Monoclonal Antibody to Myxovirus Resistance 1 (MX1)
MBS2143236-02 0.2 mL

FITC-Linked Monoclonal Antibody to Myxovirus Resistance 1 (MX1)

Ask
View Details
FITC-Linked Monoclonal Antibody to Myxovirus Resistance 1 (MX1)
MBS2143236-03 0.5 mL

FITC-Linked Monoclonal Antibody to Myxovirus Resistance 1 (MX1)

Ask
View Details