Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Swine TNF alpha Recombinant Protein

The Swine TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Swine TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086) . For research use only.

Product Specifications

Background

TNF alpha is a member of the TNF Superfamily. It is produced chiefly by activated macrophages, but it is produced also by a broad variety of cell types including lymphoid cells, mast cells, endothelial cells, cardiac myocytes, adipose tissue, fibroblasts, and neuronal tissue. The primary role of TNF alpha is in the regulation of immune cells. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Sus scrofa (pig)

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UNC80 Antibody
DF15210-01 100 µL

UNC80 Antibody

Ask
View Details
UNC80 Antibody
DF15210-02 200 µL

UNC80 Antibody

Ask
View Details
HDAC4 Recombinant Protein Lyophilized
MBS8431049 Inquire

HDAC4 Recombinant Protein Lyophilized

Ask
View Details
DR1 Double Nickase Plasmid (h)
sc-410764-NIC 20 µg

DR1 Double Nickase Plasmid (h)

Ask
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)
MBS1077865-01 0.02 mg (E-Coli)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)

Ask
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)
MBS1077865-02 0.02 mg (Yeast)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Phosphoglycerate kinase (pgk)

Ask
View Details